RLN1 (relaxin 1)

Download as csv Download as pdf

Log in to save this analysis

Save This Analysis

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases Related genes Diseases linked via similar genes

Gene

• Entrez ID: 6013
• Gene name: Relaxin 1
• Gene symbol: RLN1
• Synonyms (NCBI Gene): H1, H1RLX, RLXH1, bA12D24.3.1, bA12D24.3.2
• Chromosome: 9
• Chromosome location: 9p24.1
• Summary: Relaxins are known endocrine and autocrine/paracrine hormones, belonging to the insulin gene superfamily. In humans there are three non-allelic relaxin genes, RLN1, RLN2 and RLN3, where RLN1 and RLN2 share high sequence homology. The protein encoded by th

miRNA Show/Hide all (27)

miRTarBase ID	miRNA	Experiments	Reference
MIRT023279	hsa-miR-122-5p	Other	20859956
MIRT719937	hsa-miR-1183	HITS-CLIP	19536157
MIRT719936	hsa-miR-4742-3p	HITS-CLIP	19536157
MIRT724914	hsa-miR-1258	HITS-CLIP	19536157
MIRT719935	hsa-miR-331-5p	HITS-CLIP	19536157
MIRT719934	hsa-miR-3924	HITS-CLIP	19536157
MIRT719933	hsa-miR-4795-3p	HITS-CLIP	19536157
MIRT719932	hsa-miR-6509-5p	HITS-CLIP	19536157
MIRT719937	hsa-miR-1183	HITS-CLIP	19536157
MIRT719936	hsa-miR-4742-3p	HITS-CLIP	19536157
MIRT719935	hsa-miR-331-5p	HITS-CLIP	19536157
MIRT719934	hsa-miR-3924	HITS-CLIP	19536157
MIRT719933	hsa-miR-4795-3p	HITS-CLIP	19536157
MIRT719932	hsa-miR-6509-5p	HITS-CLIP	19536157
MIRT719937	hsa-miR-1183	HITS-CLIP	19536157
MIRT719936	hsa-miR-4742-3p	HITS-CLIP	19536157
MIRT724914	hsa-miR-1258	HITS-CLIP	19536157
MIRT719935	hsa-miR-331-5p	HITS-CLIP	19536157
MIRT719934	hsa-miR-3924	HITS-CLIP	19536157
MIRT719933	hsa-miR-4795-3p	HITS-CLIP	19536157
MIRT719932	hsa-miR-6509-5p	HITS-CLIP	19536157
MIRT719937	hsa-miR-1183	HITS-CLIP	19536157
MIRT719936	hsa-miR-4742-3p	HITS-CLIP	19536157
MIRT719935	hsa-miR-331-5p	HITS-CLIP	19536157
MIRT719934	hsa-miR-3924	HITS-CLIP	19536157
MIRT719933	hsa-miR-4795-3p	HITS-CLIP	19536157
MIRT719932	hsa-miR-6509-5p	HITS-CLIP	19536157

Transcription factors

Transcription factor	Regulation	Reference
NR3C1	Unknown	15149733
PGR	Unknown	15149733

Gene ontology (GO) Show/Hide all (6)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005179	Function	Hormone activity	IEA
GO:0005179	Function	Hormone activity	TAS	6298628
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005576	Component	Extracellular region	IEA
GO:0007165	Process	Signal transduction	NAS	6298628
GO:0007565	Process	Female pregnancy	NAS	6298628

Other IDs

• MIM: 179730
• HGNC: 10026
• e!Ensembl: ENSG00000107018

Protein

• UniProt ID: P04808
• Protein name: Prorelaxin H1 [Cleaved into: Relaxin B chain; Relaxin A chain]
• Protein function: Relaxin is an ovarian hormone that acts with estrogen to produce dilatation of the birth canal in many mammals. May be involved in remodeling of connective tissues during pregnancy, promoting growth of pubic ligaments and ripening of the cervix.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00049	Insulin	32 → 185	Insulin/IGF/Relaxin family	Domain

• Tissue specificity: TISSUE SPECIFICITY: Prostate. Not expressed in placenta, decidua or ovary. {ECO:0000269|PubMed:8735594}.
• Sequence:

  MPRLFLFHLLEFCLLLNQFSRAVAAKWKDDVIKLCGRELVRAQIAICGMSTWSKRSLSQE
  DAPQTPRPVAEIVPSFINKDTETIIIMLEFIANLPPELKAALSERQPSLPELQQYVPALK
  DSNLSFEEFKKLIRNRQSEAADSNPSELKYLGLDTHSQKKRRPYVALFEKCCLIGCTKRS
  LAKYC

• Sequence length: 185

Pathways

KEGG Pathway

Neuroactive ligand-receptor interaction

Relaxin signaling pathway

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
HYPERTROPHY	—	CTD	22028442	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining Show/Hide Text Mining Associations (14)
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	31231242		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	31231242		★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	31231242		★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	LHGDN	16172427		★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral disc disease	Pubtator	36081453	Associate	★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	26499396		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	17363522, 21696394		★☆☆☆☆ Found in Text Mining only
Malignant Testicular Germ Cell Tumor	Malignant testicular germ cell tumor	BEFREE	21696394		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	26499396		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	17363522		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	26499396	Associate	★☆☆☆☆ Found in Text Mining only
Renal fibrosis	Renal fibrosis	BEFREE	15149318		★☆☆☆☆ Found in Text Mining only
Testicular Germ Cell Tumor	Testicular Germ Cell Tumor	BEFREE	21696394		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	LHGDN	15956746		★☆☆☆☆ Found in Text Mining only

Related Genes

No strongly related genes found yet for RLN1.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to RLN1.