RIPPLY3 (ripply transcriptional repressor 3)

Download as csv Download as pdf
Log in to save this analysis

Save This Analysis

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 53820
Gene name Ripply transcriptional repressor 3
Gene symbol RIPPLY3
Synonyms (NCBI Gene)
DSCR6
Chromosome 21
Chromosome location 21q22.13
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
11 Show/Hide all (11)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IBA
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IEA
GO:0005515 Function Protein binding IPI 30241482, 32296183, 33961781, 35914814
GO:0005634 Component Nucleus IBA
GO:0005634 Component Nucleus IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
609892 3047 ENSG00000183145
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P57055
Protein name Protein ripply3 (Down syndrome critical region protein 6)
Protein function Acts as a transcriptional corepressor. Negative regulator of the transcriptional activity of TBX1. Plays a role in the development of the pharyngeal apparatus and derivatives (By similarity).
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF14998 Ripply 38 → 123 Transcription Regulator Family
Tissue specificity TISSUE SPECIFICITY: Expressed at a low level in fetal kidney and fetal brain. {ECO:0000269|PubMed:10814524}.
Sequence 
MEPEAAAGARKARGRGCHCPGDAPWRPPPPRGPESPAPWRPWIQTPGDAELTRTGRPLEP
RADQHTFGSKGAFGFQHPVRVYLPMSKRQEYLRSSGEQVLASFPVQATIDFYDDESTESA
SEAEEPEEGPPPLHLLPQEVGGRQENGPGGKGRDQGINQGQRSSGGGDHWGEGPLPQGVS
SRGGKCSSSK
Sequence length 190
Interactions View interactions

No strongly related genes found yet for RIPPLY3.

No additional diseases found yet through genes similar to RIPPLY3.