RIOX1 (ribosomal oxygenase 1)

Download as csv Download as pdf

Log in to save this analysis

Save This Analysis

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene Gene ontology Other IDs Protein Diseases linked via similar genes

Gene

• Entrez ID: 79697
• Gene name: Ribosomal oxygenase 1
• Gene symbol: RIOX1
• Synonyms (NCBI Gene): C14orf169, JMJD9, MAPJD, NO66, ROX, URLC2, hsNO66
• Chromosome: 14
• Chromosome location: 14q24.3

Gene ontology (GO) Show/Hide all (35)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005506	Function	Iron ion binding	IEA
GO:0005506	Function	Iron ion binding	ISS
GO:0005515	Function	Protein binding	IPI	19927124, 23160351
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	ISS
GO:0005654	Component	Nucleoplasm	IEA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005730	Component	Nucleolus	IBA
GO:0005730	Component	Nucleolus	IDA
GO:0005730	Component	Nucleolus	IEA
GO:0006282	Process	Regulation of DNA repair	IEA
GO:0006325	Process	Chromatin organization	IEA
GO:0006338	Process	Chromatin remodeling	IEA
GO:0016491	Function	Oxidoreductase activity	IEA
GO:0016706	Function	2-oxoglutarate-dependent dioxygenase activity	IDA	35210392
GO:0016706	Function	2-oxoglutarate-dependent dioxygenase activity	IEA
GO:0016706	Function	2-oxoglutarate-dependent dioxygenase activity	ISS
GO:0032453	Function	Histone H3K4 demethylase activity	IBA
GO:0034647	Function	Histone H3K4me/H3K4me2/H3K4me3 demethylase activity	IEA
GO:0034647	Function	Histone H3K4me/H3K4me2/H3K4me3 demethylase activity	ISS
GO:0036139	Function	Peptidyl-histidine dioxygenase activity	EXP	23103944
GO:0036139	Function	Peptidyl-histidine dioxygenase activity	IDA	23103944
GO:0036139	Function	Peptidyl-histidine dioxygenase activity	IEA
GO:0045668	Process	Negative regulation of osteoblast differentiation	IEA
GO:0045668	Process	Negative regulation of osteoblast differentiation	ISS
GO:0045892	Process	Negative regulation of DNA-templated transcription	IEA
GO:0045892	Process	Negative regulation of DNA-templated transcription	ISS
GO:0046872	Function	Metal ion binding	IEA
GO:0051213	Function	Dioxygenase activity	IEA
GO:0051864	Function	Histone H3K36 demethylase activity	IBA
GO:0051864	Function	Histone H3K36 demethylase activity	IEA
GO:0051864	Function	Histone H3K36 demethylase activity	ISS
GO:0140457	Function	Protein demethylase activity	IDA	35210392
GO:0140457	Function	Protein demethylase activity	IEA
GO:0140680	Function	Histone H3K36me/H3K36me2 demethylase activity	IEA

Other IDs

• MIM: 611919
• HGNC: 20968
• e!Ensembl: ENSG00000170468

Protein

• UniProt ID: Q9H6W3
• Protein name: Ribosomal oxygenase 1 (60S ribosomal protein L8 histidine hydroxylase) (Bifunctional lysine-specific demethylase and histidyl-hydroxylase NO66) (EC 1.14.11.27, EC 1.14.11.79) (Myc-associated protein with JmjC domain) (Nucleolar protein 66) (hsNO66) (Ribos
• Protein function: Oxygenase that can act as both a histone lysine demethylase and a ribosomal histidine hydroxylase (PubMed:23103944). Specifically demethylates 'Lys-4' (H3K4me) and 'Lys-36' (H3K36me) of histone H3, thereby playing a central role in histone code
• PDB: 4CCJ , 4CCK , 4CCM , 4CCN , 4CCO , 4DIQ , 4E4H , 4Y33 , 4Y3O , 4Y4R
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF08007	Cupin_4	215 → 557	Cupin superfamily protein	Family

• Tissue specificity: TISSUE SPECIFICITY: Widely expressed. Overexpressed in lung carcinomas. {ECO:0000269|PubMed:14742713, ECO:0000269|PubMed:17308053}.
• Sequence:

  MDGLQASAGPLRRGRPKRRRKPQPHSGSVLALPLRSRKIRKQLRSVVSRMAALRTQTLPS
  ENSEESRVESTADDLGDALPGGAAVAAVPDAARREPYGHLGPAELLEASPAARSLQTPSA
  RLVPASAPPARLVEVPAAPVRVVETSALLCTAQHLAAVQSSGAPATASGPQVDNTGGEPA
  WDSPLRRVLAELNRIPSSRRRAARLFEWLIAPMPPDHFYRRLWEREAVLVRRQDHTYYQG
  LFSTADLDSMLRNEEVQFGQHLDAARYINGRRETLNPPGRALPAAAWSLYQAGCSLRLLC
  PQAFSTTVWQFLAVLQEQFGSMAGSNVYLTPPNSQGFAPHYDDIEAFVLQLEGRKLWRVY
  RPRVPTEELALTSSPNFSQDDLGEPVLQTVLEPGDLLYFPRGFIHQAECQDGVHSLHLTL
  STYQRNTWGDFLEAILPLAVQAAMEENVEFRRGLPRDFMDYMGAQHSDSKDPRRTAFMEK
  VRVLVARLGHFAPVDAVADQRAKDFIHDSLPPVLTDRERALSVYGLPIRWEAGEPVNVGA
  QLTTETEVHMLQDGIARLVGEGGHLFLYYTVENSRVYHLEEPKCLEIYPQQADAMELLLG
  SYPEFVRVGDLPCDSVEDQLSLATTLYDKGLLLTKMPLALN

• Sequence length: 641

Related Genes

No strongly related genes found yet for RIOX1.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to RIOX1.