RHOXF2 (Rhox homeobox family member 2)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Related genes Diseases linked via similar genes

Gene

• Entrez ID: 84528
• Gene name: Rhox homeobox family member 2
• Gene symbol: RHOXF2
• Synonyms (NCBI Gene): CT107, PEPP-2, PEPP2, THG1
• Chromosome: X
• Chromosome location: Xq24
• Summary: This gene, which encodes a transcriptional repressor, is one of two paralogous X-linked homeobox-containing genes and is highly expressed in a variety of cancers. In addition, the encoded protein associates with the cell membrane and with microtubules, an

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT2090729	hsa-miR-23a	CLIP-seq
MIRT2090730	hsa-miR-23b	CLIP-seq
MIRT2090731	hsa-miR-23c	CLIP-seq

Gene ontology (GO) Show/Hide all (16)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000785	Component	Chromatin	ISA
GO:0000977	Function	RNA polymerase II transcription regulatory region sequence-specific DNA binding	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IEA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0003677	Function	DNA binding	IEA
GO:0005515	Function	Protein binding	IPI	16189514, 19060904, 19447967, 20211142, 25416956, 26871637, 31515488, 32296183, 32814053
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0010628	Process	Positive regulation of gene expression	IEA
GO:0010628	Process	Positive regulation of gene expression	IMP
GO:0042802	Function	Identical protein binding	IPI	16189514, 20211142, 25416956
GO:0048666	Process	Neuron development	IBA
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536

Other IDs

• MIM: 300447
• HGNC: 30011
• e!Ensembl: ENSG00000131721

Protein

• UniProt ID: Q9BQY4
• Protein name: Rhox homeobox family member 2 (Paired-like homeobox protein PEPP-2) (Testis homeobox gene 1)
• Protein function: Transcription factor maybe involved in reproductive processes. Modulates expression of target genes encoding proteins involved in processes relevant to spermatogenesis.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00046	Homeodomain	137 → 191	Homeodomain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Testis. Not detected in epididymis nor placenta. In testis, mainly expressed in germ cells, but also detected in somatic cells such as Sertoli cells, Leydig cells and peritubular cells (PubMed:28171660). {ECO:0000269|PubMed:12490318, E
• Sequence:

  MEPPDQCSQYMTSLLSPAVDDEKELQDMNAMVLSLTEEVKEEEEDAQPEPEQGTAAGEKL
  KSAGAQGGEEKDGGGEEKDGGGAGVPGHLWEGDLEGTSGSDGNVEDSDQSEKEPGQQYSR
  PQGAVGGLEPGNAQQPNVHAFTPLQLQELERIFQREQFPSEFLRRRLARSMNVTELAVQI
  WFENRRAKWRRHQRALMARNMLPFMAVGQPVMVTAAEAITAPLFISGMRDDYFWDHSHSS
  SLCFPMPPFPPPSLPLPLMLLPPMPPAGQAEFGPFPFVIVPSFTFPNV

• Sequence length: 288

Related Genes

No strongly related genes found yet for RHOXF2.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to RHOXF2.