Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	158800
Gene name	Rhox homeobox family member 1
Gene symbol	RHOXF1
Synonyms (NCBI Gene)	OTEXPEPP1
Chromosome	X
Chromosome location	Xq24
Summary	This gene is a member of the PEPP subfamily of paired-like homoebox genes. The gene may be regulated by androgens and epigenetic mechanisms. The encoded nuclear protein is likely a transcription factor that may play a role in human reproduction. [provided

22 Show/Hide all (22)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000785	Component	Chromatin	ISA
GO:0000977	Function	RNA polymerase II transcription regulatory region sequence-specific DNA binding	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IEA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0003677	Function	DNA binding	IEA
GO:0003677	Function	DNA binding	NAS	11980563
GO:0003700	Function	DNA-binding transcription factor activity	NAS	12490318
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	11980563
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005829	Component	Cytosol	IDA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	NAS	11980563
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0010628	Process	Positive regulation of gene expression	IMP
GO:0030521	Process	Androgen receptor signaling pathway	IEP	11980563
GO:0048666	Process	Neuron development	IBA
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IEA

MIM	HGNC	e!Ensembl
300446	29993	ENSG00000101883

Q8NHV9

Protein name

Rhox homeobox family member 1 (Ovary-, testis- and epididymis-expressed gene protein) (Paired-like homeobox protein PEPP-1)

Protein function

Transcription factor maybe involved in reproductive processes. Modulates expression of target genes encoding proteins involved in processes relevant to spermatogenesis.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00046	Homeodomain	104 → 160	Homeodomain	Domain

Tissue specificity

TISSUE SPECIFICITY: Ovary, testis and epididymis. Also detected in the prostate and the mammary gland. Expressed in many tumor cell lines derived from acute lymphocytic leukemia, prostate, endometrial adenocarcinoma, melanoma, bladder carcinoma, colon car

Sequence

MARSLVHDTVFYCLSVYQVKISPTPQLGAASSAEGHVGQGAPGLMGNMNPEGGVNHENGM
NRDGGMIPEGGGGNQEPRQQPQPPPEEPAQAAMEGPQPENMQPRTRRTKFTLLQVEELES
VFRHTQYPDVPTRRELAENLGVTEDKVRVWFKNKRARCRRHQRELMLANELRADPDDCVY
IVVD

Sequence length

184

Interactions

View interactions

Related Genes Genes most often co-reported with RHOXF1 across shared curated disease and pathway associations. 0 Download as csv Download as pdf
No strongly related genes found yet for RHOXF1.

Diseases Linked via Similar Genes Diseases curated for genes most similar to RHOXF1 (see Related Genes above), that are NOT already directly curated for RHOXF1 itself -- a lead worth checking, not a confirmed association. 0 Download as csv Download as pdf
No additional diseases found yet through genes similar to RHOXF1.

RHOXF1 (Rhox homeobox family member 1)

Bookmark This Gene