Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	442247
Gene name	Ret finger protein like 4B
Gene symbol	RFPL4B
Synonyms (NCBI Gene)	RNF211
Chromosome	6
Chromosome location	6q21

26 Show/Hide all (26)

miRTarBase ID	miRNA	Experiments
MIRT1301950	hsa-miR-140-3p	CLIP-seq
MIRT1301951	hsa-miR-3136-5p	CLIP-seq
MIRT1301952	hsa-miR-4439	CLIP-seq
MIRT1301953	hsa-miR-4474-3p	CLIP-seq
MIRT1301954	hsa-miR-4513	CLIP-seq
MIRT1301955	hsa-miR-4687-3p	CLIP-seq
MIRT1301956	hsa-miR-607	CLIP-seq
MIRT1301957	hsa-miR-943	CLIP-seq
MIRT2089599	hsa-miR-3675-3p	CLIP-seq
MIRT2089600	hsa-miR-4325	CLIP-seq
MIRT2089601	hsa-miR-507	CLIP-seq
MIRT2089602	hsa-miR-557	CLIP-seq
MIRT2089599	hsa-miR-3675-3p	CLIP-seq
MIRT2089600	hsa-miR-4325	CLIP-seq
MIRT2089601	hsa-miR-507	CLIP-seq
MIRT2089602	hsa-miR-557	CLIP-seq
MIRT2089599	hsa-miR-3675-3p	CLIP-seq
MIRT2089600	hsa-miR-4325	CLIP-seq
MIRT2089601	hsa-miR-507	CLIP-seq
MIRT2089602	hsa-miR-557	CLIP-seq
MIRT2610892	hsa-miR-127-5p	CLIP-seq
MIRT2610893	hsa-miR-139-5p	CLIP-seq
MIRT2610894	hsa-miR-548a-3p	CLIP-seq
MIRT2610895	hsa-miR-548e	CLIP-seq
MIRT2610896	hsa-miR-548f	CLIP-seq
MIRT2610897	hsa-miR-600	CLIP-seq

6 Show/Hide all (6)

GO ID	Ontology	Definition	Evidence
GO:0005737	Component	Cytoplasm	IBA
GO:0008270	Function	Zinc ion binding	IEA
GO:0010468	Process	Regulation of gene expression	IBA
GO:0045087	Process	Innate immune response	IBA
GO:0046872	Function	Metal ion binding	IEA
GO:0061630	Function	Ubiquitin protein ligase activity	IBA

MIM	HGNC	e!Ensembl
HGNC	N/A	HGNC

Q6ZWI9

Protein name

Ret finger protein-like 4B (RING finger protein 211)

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00622	SPRY	145 → 261	SPRY domain	Family
PF15227	zf-C3HC4_4	11 → 52		Domain

Sequence

MAKRLQAELSCPVCLDFFSCSISLSCTHVFCFDCIQRYILENHDFRAMCPLCRDVVKVPA
LEEWQVSVLTLMTKQHNSRLEQSLHVREELRHFREDVTLDAATASSLLVFSNDLRSAQCK
KIHHDLTKDPRLACVLGTPCFSSGQHYWEVEVGEVKSWSLGVCKEPADRKSNDLFPEHGF
WISMKAGAIHANTHLERIPASPRLRRVGIFLDADLEEIQFFDVDNNVLIYTHDGFFSLEL
LCPFFCLELLGEGESGNVLTICP

Sequence length

263

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
OLIGODENDROGLIOMA	—	GWAS catalog	36810956	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Related Genes Genes most often co-reported with RFPL4B across shared curated disease and pathway associations. 0 Download as csv Download as pdf
No strongly related genes found yet for RFPL4B.

Diseases Linked via Similar Genes Diseases curated for genes most similar to RFPL4B (see Related Genes above), that are NOT already directly curated for RFPL4B itself -- a lead worth checking, not a confirmed association. 0 Download as csv Download as pdf
No additional diseases found yet through genes similar to RFPL4B.

RFPL4B (ret finger protein like 4B)

Save This Analysis