RFPL4AL1 (ret finger protein like 4A like 1)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 729974
Gene name Ret finger protein like 4A like 1
Gene symbol RFPL4AL1
Synonyms (NCBI Gene)
RNF210B
Chromosome 19
Chromosome location 19q13.42
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
7 Show/Hide all (7)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0005737 Component Cytoplasm IBA
GO:0005737 Component Cytoplasm IEA
GO:0008270 Function Zinc ion binding IEA
GO:0010468 Process Regulation of gene expression IBA
GO:0045087 Process Innate immune response IBA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
HGNC N/A HGNC
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
F8VTS6
Protein name Ret finger protein-like 4A-like protein 1
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00622 SPRY 150 → 266 SPRY domain Family
PF11002 RDM 54 → 95 RFPL defining motif (RDM) Domain
PF13765 PRY 98 → 146 SPRY-associated domain Family
PF15227 zf-C3HC4_4 11 → 52 Domain
Sequence 
MAEHFKQIIRCPVCLKDLEEAVQLKCGYACCLQCLNSLQKEPDGEGLLCRFCSVVSQKDD
IKPKYKLRALVSIIKELEPKLKSVLTMNPRMRKFQVDMTFDVDTANNYLIISEDLRSFRS
GDLSQNRKEQAERFDTALCVLGTPRFTSGRHYWEVDVGTSQVWDVGVCKESVNRQGKIEL
SSEHGFLTVGCREGKVFAASTVPMTPLWVSPQLHRVGIFLDVGMRSIAFYNVSDGCHINT
FIEIPVCEPWRPFFAHKRGSQDDQSILSICSVINPSTASAPVSSEGK
Sequence length 287
Interactions View interactions

No strongly related genes found yet for RFPL4AL1.

No additional diseases found yet through genes similar to RFPL4AL1.