RFPL3S (RFPL3 antisense)
|
Gene
Gene information from NCBI Gene database.
|
|
| Entrez ID | 10737 |
| Gene name | RFPL3 antisense |
| Gene symbol | RFPL3S |
| Synonyms (NCBI Gene) |
NCRNA00005RFPL3-ASRFPL3-AS1RFPL3ANTRFPL3AS
|
| Chromosome | 22 |
| Chromosome location | 22q12.3 |
|
Other IDs
Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
|
|||||||
|
|||||||
|
Protein
Protein information from UniProt database.
|
|
|
UniProt ID
Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
|
P0C7P2 |
| Protein name | Putative protein RFPL3S (RFPL3 antisense RNA 1) (RFPL3 antisense gene protein 1) (Ret finger protein-like 3 antisense gene protein) |
| Family and domains | |
| Tissue specificity | TISSUE SPECIFICITY: Strongly expressed in the testis and weakly in brain, placenta and pancreas. {ECO:0000269|PubMed:10508838}. |
| Sequence |
MQTDTSNLSARSCRFCVMSPLRTLLRSSEMRRKLLAVSASKVISTVKRKTSCSASGQKPT |
| Sequence length | 107 |
| Interactions | View interactions |
|
Related Genes
Genes most often co-reported with RFPL3S across shared curated disease and pathway associations.
0
|
|
|
Diseases Linked via Similar Genes
Diseases curated for genes most similar to RFPL3S (see Related Genes above), that are NOT already directly curated for RFPL3S itself -- a lead worth checking, not a confirmed association.
0
|
|