RFPL1 (ret finger protein like 1)

Download as csv Download as pdf

Log in to save this analysis

Save This Analysis

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Diseases linked via similar genes

Gene

• Entrez ID: 5988
• Gene name: Ret finger protein like 1
• Gene symbol: RFPL1
• Synonyms (NCBI Gene): RNF78
• Chromosome: 22
• Chromosome location: 22q12.2

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT1301944	hsa-miR-129-5p	CLIP-seq
MIRT1301945	hsa-miR-450b-5p	CLIP-seq
MIRT1301946	hsa-miR-507	CLIP-seq
MIRT1301947	hsa-miR-557	CLIP-seq
MIRT1301948	hsa-miR-649	CLIP-seq

Gene ontology (GO) Show/Hide all (11)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	20725088
GO:0005737	Component	Cytoplasm	IEA
GO:0008270	Function	Zinc ion binding	IEA
GO:0010468	Process	Regulation of gene expression	IBA
GO:0010972	Process	Negative regulation of G2/M transition of mitotic cell cycle	IDA	20725088
GO:0032436	Process	Positive regulation of proteasomal ubiquitin-dependent protein catabolic process	IMP	20725088
GO:0045087	Process	Innate immune response	IBA
GO:0046872	Function	Metal ion binding	IEA
GO:0061630	Function	Ubiquitin protein ligase activity	IBA

Other IDs

• MIM: 605968
• HGNC: 9977
• e!Ensembl: ENSG00000128250

Protein

• UniProt ID: O75677
• Protein name: Ret finger protein-like 1 (RING finger protein 78)
• Protein function: Negatively regulates the G2-M phase transition, possibly by promoting cyclin B1/CCNB1 and CDK1 proteasomal degradation and thereby preventing their accumulation during interphase.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00622	SPRY	179 → 294	SPRY domain	Family
  PF11002	RDM	83 → 124	RFPL defining motif (RDM)	Domain
  PF13765	PRY	127 → 175	SPRY-associated domain	Family
  PF15227	zf-C3HC4_4	40 → 81		Domain

• Tissue specificity: TISSUE SPECIFICITY: Seems to be expressed in prostate and less abundantly in adult brain, fetal liver, and fetal kidney.
• Sequence:

  MKRLSLVTTNRLSPHGNFLPLCTFPLAVDMAALFQEASSCPVCSDYLEKPMSLECGCAVC
  FKCINSLQKEPHGEDLLCCCCSMVSQKNKIRPSWQLERLASHIKELEPKLKKILQMNPRM
  RKFQVDMTLDADTANNFLLISDDLRSVRSGCITQNRQDLAERFDVSICILGSPRFTCGRH
  YWEVDVGTSTEWDLGVCRESVHRKGRIHLTTERGFWTVSLRDGSRLSASTVPLTFLFVDR
  KLQRVGIFLDMGMQNVSFFDAEGGSHVYTFRSVSAEEPLHLFFAPPSPPNGDKSVLSICP
  VINPGTTDAPVHPGEAK

• Sequence length: 317

Related Genes

No strongly related genes found yet for RFPL1.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to RFPL1.