RETREG2 (reticulophagy regulator family member 2)

Download as csv Download as pdf

Log in to save this analysis

Save This Analysis

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Associated diseases Diseases linked via similar genes

Gene

• Entrez ID: 79137
• Gene name: Reticulophagy regulator family member 2
• Gene symbol: RETREG2
• Synonyms (NCBI Gene): C2orf17, FAM134A, MAG-2
• Chromosome: 2
• Chromosome location: 2q35

miRNA Show/Hide all (23)

miRTarBase ID	miRNA	Experiments	Reference
MIRT703713	hsa-miR-15b-3p	HITS-CLIP	23313552
MIRT703712	hsa-miR-6089	HITS-CLIP	23313552
MIRT703711	hsa-miR-6134	HITS-CLIP	23313552
MIRT703710	hsa-miR-7106-5p	HITS-CLIP	23313552
MIRT703709	hsa-miR-149-3p	HITS-CLIP	23313552
MIRT703708	hsa-miR-4728-5p	HITS-CLIP	23313552
MIRT703707	hsa-miR-6785-5p	HITS-CLIP	23313552
MIRT703706	hsa-miR-6883-5p	HITS-CLIP	23313552
MIRT703705	hsa-miR-6799-5p	HITS-CLIP	23313552
MIRT703704	hsa-miR-6769a-5p	HITS-CLIP	23313552
MIRT703703	hsa-miR-6769b-5p	HITS-CLIP	23313552
MIRT703702	hsa-miR-6748-5p	HITS-CLIP	23313552
MIRT703701	hsa-miR-30c-1-3p	HITS-CLIP	23313552
MIRT703700	hsa-miR-30c-2-3p	HITS-CLIP	23313552
MIRT703699	hsa-miR-6788-5p	HITS-CLIP	23313552
MIRT703697	hsa-miR-1262	HITS-CLIP	23313552
MIRT703698	hsa-miR-4701-3p	HITS-CLIP	23313552
MIRT703696	hsa-miR-6736-5p	HITS-CLIP	23313552
MIRT703695	hsa-miR-450a-1-3p	HITS-CLIP	23313552
MIRT703694	hsa-miR-3122	HITS-CLIP	23313552
MIRT703693	hsa-miR-3913-5p	HITS-CLIP	23313552
MIRT703692	hsa-miR-887-5p	HITS-CLIP	23313552
MIRT703691	hsa-miR-6513-5p	HITS-CLIP	23313552

Gene ontology (GO) Show/Hide all (11)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	21900206, 26040720
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	IEA
GO:0006914	Process	Autophagy	IEA
GO:0007029	Process	Endoplasmic reticulum organization	IEA
GO:0016020	Component	Membrane	IBA
GO:0016020	Component	Membrane	IEA
GO:0030574	Process	Collagen catabolic process	IEA
GO:0061709	Process	Reticulophagy	IEA
GO:0061753	Process	Substrate localization to autophagosome	IEA
GO:0140506	Function	Endoplasmic reticulum-autophagosome adaptor activity	IEA

Other IDs

• MIM: HGNC
• HGNC: N/A
• e!Ensembl: HGNC

Protein

• UniProt ID: Q8NC44
• Protein name: Reticulophagy regulator 2
• Protein function: Endoplasmic reticulum (ER)-anchored autophagy regulator which exists in an inactive state under basal conditions but is activated following cellular stress (PubMed:34338405). When activated, induces ER fragmentation and mediates ER delivery into
• PDB: 6EWC
• Sequence:

  MASGGGGGNTGAGGGPGMGLSLGLGLGLSLGMSEATSEAEEEAATAEAVGRLATTLWLRL
  RGWEAVLAAAQRLLVWEKPLHSLVTAAALNGLFWLLSSSSLRPFFLLSVSLLAYFLLDLW
  QPRFLPDVSASSPEEPHSDSEGAGSGARPHLLSVPELCRYLAESWLTFQIHLQELLQYKR
  QNPAQFCVRVCSGCAVLAVLGHYVPGIMISYIVLLSILLWPLVVYHELIQRMYTRLEPLL
  MQLDYSMKAEANALHHKHDKRKRQGKNAPPGGDEPLAETESESEAELAGFSPVVDVKKTA
  LALAITDSELSDEEASILESGGFSVSRATTPQLTDVSEDLDQQSLPSEPEETLSRDLGEG
  EEGELAPPEDLLGRPQALSRQALDSEEEEEDVAAKETLLRLSSPLHFVNTHFNGAGSPPD
  GVKCSPGGPVETLSPETVSGGLTALPGTLSPPLCLVGSDPAPSPSILPPVPQDSPQPLPA
  PEEEEALTTEDFELLDQGELEQLNAELGLEPETPPKPPDAPPLGPDIHSLVQSDQEAQAV
  AEP

• Sequence length: 543

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
SCHIZOPHRENIA	—	Disgenet, GWAS catalog Disgenet, GWAS catalog	32606422	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining Show/Hide Text Mining Associations (7)
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Carcinoma of lung	Lung carcinoma	BEFREE	19212629		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	33504897	Associate	★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	33504897	Associate	★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	19212629		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	19212629, 29440427		★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	23474461		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	PSYGENET_DG	23474461		★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Related Genes

No strongly related genes found yet for RETREG2.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to RETREG2.