REP15 (RAB15 effector protein)

Download as csv Download as pdf

Log in to save this analysis

Save This Analysis

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Related genes Diseases linked via similar genes

Gene

• Entrez ID: 387849
• Gene name: RAB15 effector protein
• Gene symbol: REP15
• Synonyms (NCBI Gene): RAB15EP
• Chromosome: 12
• Chromosome location: 12p11.22
• Summary: The protein encoded by this intronless gene interacts with GTP-bound Rab15 and is involved in recycling of transferrin receptor from the endocytic recycling compartment to the cell surface. [provided by RefSeq, Sep 2016]

miRNA Show/Hide all (13)

miRTarBase ID	miRNA	Experiments	Reference
MIRT2089257	hsa-miR-129-5p	CLIP-seq
MIRT2089258	hsa-miR-450b-5p	CLIP-seq
MIRT2089259	hsa-miR-507	CLIP-seq
MIRT2089260	hsa-miR-518a-5p	CLIP-seq
MIRT2089261	hsa-miR-527	CLIP-seq
MIRT2089262	hsa-miR-557	CLIP-seq
MIRT2314073	hsa-miR-1200	CLIP-seq
MIRT2314074	hsa-miR-3074-5p	CLIP-seq
MIRT2314075	hsa-miR-3140-5p	CLIP-seq
MIRT2314076	hsa-miR-3545-3p	CLIP-seq
MIRT2314077	hsa-miR-452	CLIP-seq
MIRT2314078	hsa-miR-4539	CLIP-seq
MIRT2314079	hsa-miR-4676-3p	CLIP-seq

Gene ontology (GO) Show/Hide all (14)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001881	Process	Receptor recycling	IBA
GO:0001881	Process	Receptor recycling	IEA
GO:0001881	Process	Receptor recycling	IMP	16195351
GO:0005515	Function	Protein binding	IPI	16195351, 32296183, 33961781
GO:0005768	Component	Endosome	IEA
GO:0010008	Component	Endosome membrane	IBA
GO:0010008	Component	Endosome membrane	IDA	16195351
GO:0016020	Component	Membrane	IEA
GO:0031901	Component	Early endosome membrane	IEA
GO:0033572	Process	Transferrin transport	IBA
GO:0033572	Process	Transferrin transport	IDA	16195351
GO:0048471	Component	Perinuclear region of cytoplasm	IDA	16195351
GO:0055037	Component	Recycling endosome	IBA
GO:0055037	Component	Recycling endosome	IDA	16195351

Other IDs

• MIM: 610848
• HGNC: 33748
• e!Ensembl: ENSG00000174236

Protein

• UniProt ID: Q6BDI9
• Protein name: Rab15 effector protein
• Protein function: Effector that interacts with Rab GTPases in their active form (GTP-bound) including RAB15, RAB3A-D and RAB34. Controls downstream signaling such as cell proliferation and cell migration (PubMed:35871249). Also regulates transferrin receptor recy
• PDB: 8A4A , 8A4B , 8A4C
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF15208	Rab15_effector	1 → 236	Rab15 effector	Family

• Sequence:

  MGQKASQQLALKDSKEVPVVCEVVSEAIVHAAQKLKEYLGFEYPPSKLCPAANTLNEIFL
  IHFITFCQEKGVDEWLTTTKMTKHQAFLFGADWIWTFWGSNKQIKLQLAVQTLQMSSPPP
  VESKPCDLSNPESRVEESSWKKSRFDKLEEFCNLIGEDCLGLFIIFGMPGKPKDIRGVVL
  DSVKSQMVRSHLPGGKAVAQFVLETEDCVFIKELLRNCLSKKDGLREVGKVYISIL

• Sequence length: 236

Related Genes

No strongly related genes found yet for REP15.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to REP15.