Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	161253
Gene name	RRAD and GEM like GTPase 2
Gene symbol	REM2
Synonyms (NCBI Gene)	-
Chromosome	14
Chromosome location	14q11.2

11 Show/Hide all (11)

miRTarBase ID	miRNA	Experiments	Reference
MIRT023952	hsa-miR-1-3p	Microarray	18668037
MIRT1300295	hsa-miR-3656	CLIP-seq
MIRT1300296	hsa-miR-3689d	CLIP-seq
MIRT1300297	hsa-miR-3911	CLIP-seq
MIRT1300298	hsa-miR-4455	CLIP-seq
MIRT1300299	hsa-miR-4632	CLIP-seq
MIRT2089256	hsa-miR-4655-5p	CLIP-seq
MIRT2610666	hsa-miR-3140-3p	CLIP-seq
MIRT2610667	hsa-miR-3180-5p	CLIP-seq
MIRT2610668	hsa-miR-520a-5p	CLIP-seq
MIRT2610669	hsa-miR-525-5p	CLIP-seq

9 Show/Hide all (9)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0003924	Function	GTPase activity	IEA
GO:0005246	Function	Calcium channel regulator activity	IBA
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005525	Function	GTP binding	IBA
GO:0005525	Function	GTP binding	IEA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IEA
GO:0016020	Component	Membrane	IEA

MIM	HGNC	e!Ensembl
616955	20248	ENSG00000139890

Q8IYK8

Protein name

GTP-binding protein REM 2 (Rad and Gem-like GTP-binding protein 2)

Protein function

Binds GTP saturably and exhibits a low intrinsic rate of GTP hydrolysis.

PDB

3CBQ

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00071	Ras	116 → 279	Ras family	Domain

Sequence

MHTDLDTDMDMDTETTALCPSGSRRASPPGTPTPEADATLLKKSEKLLAELDRSGLPSAP
GAPRRRGSMPVPYKHQLRRAQAVDELDWPPQASSSGSSDSLGSGEAAPAQKDGIFKVMLV
GESGVGKSTLAGTFGGLQGDSAHEPENPEDTYERRIMVDKEEVTLVVYDIWEQGDAGGWL
RDHCLQTGDAFLIVFSVTDRRSFSKVPETLLRLRAGRPHHDLPVILVGNKSDLARSREVS
LEEGRHLAGTLSCKHIETSAALHHNTRELFEGAVRQIRLRRGRNHAGGQRPDPGSPEGPA
PPARRESLTKKAKRFLANLVPRNAKFFKQRSRSCHDLSVL

Sequence length

340

Interactions

View interactions

Related Genes Genes most often co-reported with REM2 across shared curated disease and pathway associations. 0 Download as csv Download as pdf
No strongly related genes found yet for REM2.

Diseases Linked via Similar Genes Diseases curated for genes most similar to REM2 (see Related Genes above), that are NOT already directly curated for REM2 itself -- a lead worth checking, not a confirmed association. 0 Download as csv Download as pdf
No additional diseases found yet through genes similar to REM2.

REM2 (RRAD and GEM like GTPase 2)

Bookmark This Gene