REG3A (regenerating family member 3 alpha)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene Gene ontology Other IDs Protein Pathways Related genes Diseases linked via similar genes

Gene

• Entrez ID: 5068
• Gene name: Regenerating family member 3 alpha
• Gene symbol: REG3A
• Synonyms (NCBI Gene): HIP, HIP/PAP, INGAP, PAP, PAP-H, PAP1, PBCGF, REG-III, REG3
• Chromosome: 2
• Chromosome location: 2p12
• Summary: This gene encodes a pancreatic secretory protein that may be involved in cell proliferation or differentiation. It has similarity to the C-type lectin superfamily. The enhanced expression of this gene is observed during pancreatic inflammation and liver c

Gene ontology (GO) Show/Hide all (37)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005179	Function	Hormone activity	IDA	22727489, 27830702
GO:0005179	Function	Hormone activity	ISS	36240758
GO:0005515	Function	Protein binding	IPI	25416956
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IDA	22727489, 27830702
GO:0005615	Component	Extracellular space	ISS	36240758
GO:0005615	Component	Extracellular space	TAS	8997243
GO:0005737	Component	Cytoplasm	TAS	8997243
GO:0006953	Process	Acute-phase response	IEA
GO:0006954	Process	Inflammatory response	IEA
GO:0007157	Process	Heterophilic cell-cell adhesion via plasma membrane cell adhesion molecules	TAS	8997243
GO:0008284	Process	Positive regulation of cell population proliferation	IBA
GO:0009609	Process	Response to symbiotic bacterium	ISS	36240758
GO:0009611	Process	Response to wounding	IDA	22727489
GO:0010838	Process	Positive regulation of keratinocyte proliferation	IDA	22727489
GO:0010838	Process	Positive regulation of keratinocyte proliferation	IDA	22727489
GO:0010838	Process	Positive regulation of keratinocyte proliferation	ISS
GO:0030246	Function	Carbohydrate binding	IEA
GO:0030246	Function	Carbohydrate binding	TAS	1325291
GO:0038023	Function	Signaling receptor activity	IBA
GO:0042802	Function	Identical protein binding	IPI	24256734
GO:0042834	Function	Peptidoglycan binding	IBA
GO:0043434	Process	Response to peptide hormone	IBA
GO:0043491	Process	Phosphatidylinositol 3-kinase/protein kinase B signal transduction	IDA	27830702
GO:0045617	Process	Negative regulation of keratinocyte differentiation	IDA	22727489
GO:0045617	Process	Negative regulation of keratinocyte differentiation	ISS
GO:0051897	Process	Positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	IDA	22727489, 27830702
GO:0061844	Process	Antimicrobial humoral immune response mediated by antimicrobial peptide	IBA
GO:0070492	Function	Oligosaccharide binding	IBA
GO:0090303	Process	Positive regulation of wound healing	ISS
GO:0090594	Process	Inflammatory response to wounding	IDA	27830702
GO:0106015	Process	Negative regulation of inflammatory response to wounding	IDA	27830702
GO:0106015	Process	Negative regulation of inflammatory response to wounding	IDA	27830702
GO:1900017	Process	Positive regulation of cytokine production involved in inflammatory response	IDA	8654373
GO:2000972	Process	Positive regulation of detection of glucose	ISS	36240758

Other IDs

• MIM: 167805
• HGNC: 8601
• e!Ensembl: ENSG00000172016

Protein

• UniProt ID: Q06141
• Protein name: Regenerating islet-derived protein 3-alpha (REG-3-alpha) (Hepatointestinal pancreatic protein) (HIP/PAP) (Human proislet peptide) (HIP) (Pancreatitis-associated protein 1) (Regenerating islet-derived protein III-alpha) (Reg III-alpha) [Cleaved into: Regen
• Protein function: [Regenerating islet-derived protein 3-alpha 15 kDa form]: Bactericidal C-type lectin which acts exclusively against Gram-positive bacteria and mediates bacterial killing by binding to surface-exposed carbohydrate moieties of peptidoglycan (PubMe
• PDB: 1UV0 , 2GO0 , 4MTH
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00059	Lectin_C	57 → 173	Lectin C-type domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Expressed by keratinocytes (PubMed:27830702). Highly expressed in epidermal keratinocytes of psoriasis patients (at protein level) (PubMed:22727489). Constitutively expressed in intestine. Low expression is found in healthy pancreas. O
• Sequence:

  MLPPMALPSVSWMLLSCLMLLSQVQGEEPQRELPSARIRCPKGSKAYGSHCYALFLSPKS
  WTDADLACQKRPSGNLVSVLSGAEGSFVSSLVKSIGNSYSYVWIGLHDPTQGTEPNGEGW
  EWSSSDVMNYFAWERNPSTISSPGHCASLSRSTAFLRWKDYNCNVRLPYVCKFTD

• Sequence length: 175

Pathways

Reactome Pathway:

Antimicrobial peptides

Related Genes

No strongly related genes found yet for REG3A.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to REG3A.