REG1B (regenerating family member 1 beta)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Related genes Diseases linked via similar genes

Gene

• Entrez ID: 5968
• Gene name: Regenerating family member 1 beta
• Gene symbol: REG1B
• Synonyms (NCBI Gene): PSPS2, REGH, REGI-BETA, REGL
• Chromosome: 2
• Chromosome location: 2p12
• Summary: This gene is a type I subclass member of the Reg gene family. The Reg gene family is a multigene family grouped into four subclasses, types I, II, III and IV based on the primary structures of the encoded proteins. This gene encodes a protein secreted by

miRNA Show/Hide all (14)

miRTarBase ID	miRNA	Experiments	Reference
MIRT1299958	hsa-miR-125a-3p	CLIP-seq
MIRT1299959	hsa-miR-4329	CLIP-seq
MIRT1299960	hsa-miR-4499	CLIP-seq
MIRT1299961	hsa-miR-518d-5p	CLIP-seq
MIRT1299962	hsa-miR-519b-5p	CLIP-seq
MIRT1299963	hsa-miR-519c-5p	CLIP-seq
MIRT1299964	hsa-miR-520c-5p	CLIP-seq
MIRT1299965	hsa-miR-526a	CLIP-seq
MIRT1299966	hsa-miR-552	CLIP-seq
MIRT2313994	hsa-miR-376a	CLIP-seq
MIRT2313995	hsa-miR-376b	CLIP-seq
MIRT2313996	hsa-miR-4775	CLIP-seq
MIRT2313997	hsa-miR-590-3p	CLIP-seq
MIRT2313998	hsa-miR-617	CLIP-seq

Gene ontology (GO) Show/Hide all (11)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	28514442, 33961781
GO:0005576	Component	Extracellular region	IEA
GO:0005615	Component	Extracellular space	IBA
GO:0008284	Process	Positive regulation of cell population proliferation	IBA
GO:0030246	Function	Carbohydrate binding	IEA
GO:0038023	Function	Signaling receptor activity	IBA
GO:0042834	Function	Peptidoglycan binding	IBA
GO:0043434	Process	Response to peptide hormone	IBA
GO:0061844	Process	Antimicrobial humoral immune response mediated by antimicrobial peptide	IBA
GO:0070062	Component	Extracellular exosome	HDA	23533145
GO:0070492	Function	Oligosaccharide binding	IBA

Other IDs

• MIM: 167771
• HGNC: 9952
• e!Ensembl: ENSG00000172023

Protein

• UniProt ID: P48304
• Protein name: Lithostathine-1-beta (Pancreatic stone protein 2) (PSP-2) (Regenerating islet-derived protein 1-beta) (REG-1-beta) (Regenerating protein I beta)
• Protein function: Might act as an inhibitor of spontaneous calcium carbonate precipitation. May be associated with neuronal sprouting in brain, and with brain and pancreas regeneration.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00059	Lectin_C	53 → 164	Lectin C-type domain	Domain

• Sequence:

  MAQTNSFFMLISSLMFLSLSQGQESQTELPNPRISCPEGTNAYRSYCYYFNEDPETWVDA
  DLYCQNMNSGNLVSVLTQAEGAFVASLIKESSTDDSNVWIGLHDPKKNRRWHWSSGSLVS
  YKSWDTGSPSSANAGYCASLTSCSGFKKWKDESCEKKFSFVCKFKN

• Sequence length: 166

Related Genes

No strongly related genes found yet for REG1B.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to REG1B.