RDM1 (RAD52 motif containing 1)

Download as csv Download as pdf
Log in to save this analysis

Save This Analysis

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 201299
Gene name RAD52 motif containing 1
Gene symbol RDM1
Synonyms (NCBI Gene)
RAD52B
Chromosome 17
Chromosome location 17q12
Summary This gene encodes a protein involved in the cellular response to cisplatin, a drug commonly used in chemotherapy. The protein encoded by this gene contains two motifs: a motif found in RAD52, a protein that functions in DNA double-strand breaks and homolo
miRNA miRNA information provided by mirtarbase database.
2
Download as csvDownload as pdf
miRTarBase ID miRNA Experiments Reference
MIRT024931 hsa-miR-215-5p Microarray 19074876
MIRT026561 hsa-miR-192-5p Microarray 19074876
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
12 Show/Hide all (12)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0003676 Function Nucleic acid binding IEA
GO:0003677 Function DNA binding IEA
GO:0003723 Function RNA binding IEA
GO:0005515 Function Protein binding IPI 25416956, 32296183
GO:0005634 Component Nucleus IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
612896 19950 ENSG00000278023
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q8NG50
Protein name RAD52 motif-containing protein 1 (RAD52 homolog B)
Protein function May confer resistance to the antitumor agent cisplatin. Binds to DNA and RNA.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00076 RRM_1 27 → 90 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Domain
Tissue specificity TISSUE SPECIFICITY: Expressed in testis. {ECO:0000269|PubMed:15611051}.
Sequence 
MAELVPFAVPIESDKTLLVWELSSGPTAEALHHSLFTAFSQFGLLYSVRVFPNAAVAHPG
FYAVIKFYSARAAHRAQKACDRKQLFQKSPVKVRLGTRHKAVQHQALALNSSKCQELANY
YFGFNGCSKRIIKLQELSDLEERENEDSMVPLPKQSLKFFCALEVVLPSCDCRSPGIGLV
EEPMDKVEEGPLSFLMKRKTAQKLAIQKALSDAFQKLLIVVLESGKIAVEYRPSEDIVGV
RCEEELHGLIQVPCSPWKQYGQEEEGYLSDFSLEEEEFRLPELD
Sequence length 284
Interactions View interactions

No strongly related genes found yet for RDM1.

No additional diseases found yet through genes similar to RDM1.