Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	5957
Gene name	Recoverin
Gene symbol	RCVRN
Synonyms (NCBI Gene)	RCV1
Chromosome	17
Chromosome location	17p13.1
Summary	This gene encodes a member of the recoverin family of neuronal calcium sensors. The encoded protein contains three calcium-binding EF-hand domains and may prolong the termination of the phototransduction cascade in the retina by blocking the phosphorylati

27 Show/Hide all (27)

miRTarBase ID	miRNA	Experiments	Reference
MIRT017646	hsa-miR-335-5p	Microarray	18185580
MIRT736087	hsa-let-7a-3p	RNA-seq	31579443
MIRT1298825	hsa-miR-1252	CLIP-seq
MIRT1298826	hsa-miR-3185	CLIP-seq
MIRT1298827	hsa-miR-3667-5p	CLIP-seq
MIRT1298828	hsa-miR-3914	CLIP-seq
MIRT1298829	hsa-miR-4783-5p	CLIP-seq
MIRT1298830	hsa-miR-933	CLIP-seq
MIRT2313782	hsa-miR-1207-5p	CLIP-seq
MIRT2313783	hsa-miR-1271	CLIP-seq
MIRT2313784	hsa-miR-182	CLIP-seq
MIRT2313785	hsa-miR-3117-3p	CLIP-seq
MIRT2313786	hsa-miR-3117-5p	CLIP-seq
MIRT2313787	hsa-miR-3169	CLIP-seq
MIRT2313788	hsa-miR-3607-5p	CLIP-seq
MIRT2313789	hsa-miR-3977	CLIP-seq
MIRT2313790	hsa-miR-4270	CLIP-seq
MIRT2313791	hsa-miR-4328	CLIP-seq
MIRT2313792	hsa-miR-4441	CLIP-seq
MIRT2313793	hsa-miR-4481	CLIP-seq
MIRT2313794	hsa-miR-4536	CLIP-seq
MIRT2313795	hsa-miR-4736	CLIP-seq
MIRT2313796	hsa-miR-4745-5p	CLIP-seq
MIRT2313797	hsa-miR-4758-5p	CLIP-seq
MIRT2313798	hsa-miR-4759	CLIP-seq
MIRT2313799	hsa-miR-4763-3p	CLIP-seq
MIRT2313800	hsa-miR-96	CLIP-seq

18 Show/Hide all (18)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001750	Component	Photoreceptor outer segment	IEA
GO:0001917	Component	Photoreceptor inner segment	IEA
GO:0005509	Function	Calcium ion binding	IBA
GO:0005509	Function	Calcium ion binding	IEA
GO:0005509	Function	Calcium ion binding	TAS	1672047
GO:0007165	Process	Signal transduction	TAS	1672047
GO:0007601	Process	Visual perception	IEA
GO:0007601	Process	Visual perception	IEA
GO:0007601	Process	Visual perception	TAS	1672047
GO:0007602	Process	Phototransduction	IEA
GO:0008048	Function	Calcium sensitive guanylate cyclase activator activity	TAS	1672047
GO:0009966	Process	Regulation of signal transduction	IBA
GO:0016020	Component	Membrane	IEA
GO:0030425	Component	Dendrite	IEA
GO:0042995	Component	Cell projection	IEA
GO:0043204	Component	Perikaryon	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0051924	Process	Regulation of calcium ion transport	IEA

MIM	HGNC	e!Ensembl
179618	9937	ENSG00000109047

P35243

Protein name

Recoverin (Cancer-associated retinopathy protein) (Protein CAR)

Protein function

Acts as a calcium sensor and regulates phototransduction of cone and rod photoreceptor cells (By similarity). Modulates light sensitivity of cone photoreceptor in dark and dim conditions (By similarity). In response to high Ca(2+) levels induced

PDB

2D8N

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF13499	EF-hand_7	99 → 177	EF-hand domain pair	Domain
PF13833	EF-hand_8	40 → 93	EF-hand domain pair	Domain

Tissue specificity

TISSUE SPECIFICITY: Retina and pineal gland.

Sequence

MGNSKSGALSKEILEELQLNTKFSEEELCSWYQSFLKDCPTGRITQQQFQSIYAKFFPDT
DPKAYAQHVFRSFDSNLDGTLDFKEYVIALHMTTAGKTNQKLEWAFSLYDVDGNGTISKN
EVLEIVMAIFKMITPEDVKLLPDDENTPEKRAEKIWKYFGKNDDDKLTEKEFIEGTLANK
EILRLIQFEPQKVKEKMKNA

Sequence length

200

Interactions

View interactions

KEGG Pathway	Reactome Pathway
Phototransduction	Inactivation, recovery and regulation of the phototransduction cascade

RCVRN (recoverin)

Bookmark This Gene