RBP7 (retinol binding protein 7)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 116362
Gene name Retinol binding protein 7
Gene symbol RBP7
Synonyms (NCBI Gene)
CRABP4CRBP4CRBPIV
Chromosome 1
Chromosome location 1p36.22
Summary The protein encoded by this gene is a member of the cellular retinol-binding protein (CRBP) family, whose members are required for vitamin A stability and metabolism. The encoded protein binds all-trans-retinol and is structurally similar to other CRBPs;
miRNA miRNA information provided by mirtarbase database.
2
Download as csvDownload as pdf
miRTarBase ID miRNA Experiments Reference
MIRT024360 hsa-miR-215-5p Microarray 19074876
MIRT026505 hsa-miR-192-5p Microarray 19074876
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
10 Show/Hide all (10)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0005501 Function Retinoid binding IEA
GO:0005504 Function Fatty acid binding IBA
GO:0005515 Function Protein binding IPI 25814554, 32296183
GO:0005634 Component Nucleus IBA
GO:0005737 Component Cytoplasm IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
608604 30316 ENSG00000162444
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q96R05
Protein name Retinoid-binding protein 7 (Cellular retinoic acid-binding protein 4) (CRABP4) (CRBP4) (Cellular retinoic acid-binding protein IV) (CRABP-IV)
Protein function Intracellular transport of retinol.
PDB 1LPJ , 6AT8 , 6E6K
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00061 Lipocalin 6 → 134 Lipocalin / cytosolic fatty-acid binding protein family Domain
Tissue specificity TISSUE SPECIFICITY: Expressed primarily in kidney, heart and transverse colon. Detected in adult lymph node, appendix, ascending colon, and in fetal heart and spleen. {ECO:0000269|PubMed:12177003}.
Sequence 
MPADLSGTWTLLSSDNFEGYMLALGIDFATRKIAKLLKPQKVIEQNGDSFTIHTNSSLRN
YFVKFKVGEEFDEDNRGLDNRKCKSLVIWDNDRLTCIQKGEKKNRGWTHWIEGDKLHLEM
FCEGQVCKQTFQRA
Sequence length 134
Interactions View interactions

No strongly related genes found yet for RBP7.

No additional diseases found yet through genes similar to RBP7.