RBP5 (retinol binding protein 5)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 83758
Gene name Retinol binding protein 5
Gene symbol RBP5
Synonyms (NCBI Gene)
CRBP-IIICRBP3CRBPIIIHRBPiso
Chromosome 12
Chromosome location 12p13.31
Summary The protein encoded by this gene is a cellular retinol-binding protein expressed highly in kidney and liver. Down-regulation of the encoded protein in hepatocellular carcinoma was associated with large tumor size and poor patient survival rates. [provided
miRNA miRNA information provided by mirtarbase database.
6 Show/Hide all (6)
Download as csvDownload as pdf
miRTarBase ID miRNA Experiments Reference
MIRT1297395 hsa-miR-1294 CLIP-seq
MIRT1297396 hsa-miR-192 CLIP-seq
MIRT1297397 hsa-miR-215 CLIP-seq
MIRT1297398 hsa-miR-3661 CLIP-seq
MIRT1297399 hsa-miR-619 CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
11 Show/Hide all (11)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0005501 Function Retinoid binding TAS 11274389
GO:0005504 Function Fatty acid binding IBA
GO:0005515 Function Protein binding IPI 25416956, 32296183
GO:0005634 Component Nucleus IBA
GO:0005737 Component Cytoplasm IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
611866 15847 ENSG00000139194
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P82980
Protein name Retinol-binding protein 5 (Cellular retinol-binding protein III) (CRBP-III) (HRBPiso)
Protein function Intracellular transport of retinol.
PDB 1GGL , 6E5W , 9BCB
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00061 Lipocalin 6 → 134 Lipocalin / cytosolic fatty-acid binding protein family Domain
Tissue specificity TISSUE SPECIFICITY: Higher expression in adult kidney and liver and to a lesser extent in adult and fetal spleen, adult lymph nodes and appendix, and fetal liver and kidney. Strongly decreased in hepatocellular carcinoma tissues (at protein level). {ECO:0
Sequence 
MPPNLTGYYRFVSQKNMEDYLQALNISLAVRKIALLLKPDKEIEHQGNHMTVRTLSTFRN
YTVQFDVGVEFEEDLRSVDGRKCQTIVTWEEEHLVCVQKGEVPNRGWRHWLEGEMLYLEL
TARDAVCEQVFRKVR
Sequence length 135
Interactions View interactions

No strongly related genes found yet for RBP5.

No additional diseases found yet through genes similar to RBP5.