RBMY1E (RNA binding motif protein Y-linked family 1 member E)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 378950
Gene name RNA binding motif protein Y-linked family 1 member E
Gene symbol RBMY1E
Synonyms (NCBI Gene)
-
Chromosome Y
Chromosome location Yq11.223
Summary This gene encodes a protein containing an RNA-binding motif in the N-terminus and four SRGY (serine, arginine, glycine, tyrosine) boxes in the C-terminus. Multiple copies of this gene are found in the AZFb azoospermia factor region of chromosome Y and the
miRNA miRNA information provided by mirtarbase database.
10 Show/Hide all (10)
Download as csvDownload as pdf
miRTarBase ID miRNA Experiments Reference
MIRT644785 hsa-miR-3121-5p HITS-CLIP 23824327
MIRT644784 hsa-miR-570-3p HITS-CLIP 23824327
MIRT644783 hsa-miR-5585-3p HITS-CLIP 23824327
MIRT644785 hsa-miR-3121-5p HITS-CLIP 23824327
MIRT644784 hsa-miR-570-3p HITS-CLIP 23824327
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
11 Show/Hide all (11)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0003676 Function Nucleic acid binding IEA
GO:0003723 Function RNA binding IBA
GO:0003723 Function RNA binding IEA
GO:0005515 Function Protein binding IPI 32296183
GO:0005634 Component Nucleus IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
HGNC N/A HGNC
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
A6NEQ0
Protein name RNA-binding motif protein, Y chromosome, family 1 member E
Protein function RNA-binding protein which may be involved in spermatogenesis. Required for sperm development, possibly by participating in pre-mRNA splicing in the testis.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00076 RRM_1 10 → 79 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Domain
PF08081 RBM1CTR 174 → 218 RBM1CTR (NUC064) family Family
Tissue specificity TISSUE SPECIFICITY: Testis-specific.
Sequence 
MVEADHPGKLFIGGLNRETNEKMLKAVFGKHGPISEVLLIKDRTSKSRGFAFITFENPAD
AKNAAKDMNGKSLHGKAIKVEQAKKPSFQSGGRRRPPASSRNRSPSGSLRSARGSRGGTR
GWLPSQEGHLDDGGYTPDLKMSYSRGLIPVKRGPSSRSGGPPPKKSAPSAVARSNSWMGS
QGPMSQRRENYGVPPRRATISSWRNDRMSTRHDGYATNDGNHPSCQETRDYAPPSRGYAY
RDNGHSNRDEHSSRGYRNHRSSRETRDYAPPSRGHAYRDYGHSRRDESYSRGYRNRRSSR
ETREYAPPSRGHGYRDYGHSRRHESYSRGYRNHPSSRETRDYAPPHRDYAYRDYGHSSWD
EHSSRGYSYHDGYGEALGRDHSEHLSGSSYRDALQRYGTAHGAPPARGPRMSYGGSTCHA
YSNTRDRYGRSWESYSSCGDFHYCDREHVCRKDQRNPPSLGRVLPDPREACGSSSYVASI
VDGGESRSEKGDSSRY
Sequence length 496
Interactions View interactions

No strongly related genes found yet for RBMY1E.

No additional diseases found yet through genes similar to RBMY1E.