Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	5942
Gene name	RNA binding motif protein Y-linked family 1 member C
Gene symbol	RBMY1C
Synonyms (NCBI Gene)	-
Chromosome	Y
Chromosome location	Yq11.23

14 Show/Hide all (14)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003676	Function	Nucleic acid binding	IEA
GO:0003723	Function	RNA binding	IBA
GO:0003723	Function	RNA binding	IEA
GO:0003723	Function	RNA binding	IMP	10749975
GO:0005515	Function	Protein binding	IPI	10332027, 10749975
GO:0005634	Component	Nucleus	IDA	10749975
GO:0005634	Component	Nucleus	IEA
GO:0005681	Component	Spliceosomal complex	IBA
GO:0006397	Process	MRNA processing	IEA
GO:0008380	Process	RNA splicing	IEA
GO:0032991	Component	Protein-containing complex	IMP	10749975
GO:0042802	Function	Identical protein binding	IPI	10749975
GO:0043484	Process	Regulation of RNA splicing	IMP	10749975
GO:0048026	Process	Positive regulation of mRNA splicing, via spliceosome	IBA

MIM	HGNC	e!Ensembl
HGNC	9914	N/A

P0DJD4

Protein name

RNA-binding motif protein, Y chromosome, family 1 member C

Protein function

RNA-binding protein involved in pre-mRNA splicing. Required for sperm development. Acts additively with TRA2B to promote exon 7 inclusion of the survival motor neuron SMN. Binds non-specifically to mRNAs.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00076	RRM_1	10 → 79	RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)	Domain
PF08081	RBM1CTR	174 → 218	RBM1CTR (NUC064) family	Family

Tissue specificity

TISSUE SPECIFICITY: Testis-specific.

Sequence

MVEADHPGKLFIGGLNRETNEKMLKAVFGKHGPISEVLLIKDRTSKSRGFAFITFENPAD
AKNAAKDMNGKSLHGKAIKVEQAQKPSFQSGGRRRPPASSRNRSPSGSLRSARGSRGGTR
GWLPSHEGHLDDGGYTPDLKMSYSRGLIPVKRGPSSRSGGPPPKKSAPSAVARSNSWMGS
QGPMSQRRENYGVPPRRATISSWRNDRMSTRHDGYATNDGNHPSCQETRDYAPPSRGYAY
RDNGHSNRDEHSSRGYRNHRSSRETRDYAPPSRGHAYRDYGHSRRDESYSRGYRNRRSSR
ETREYAPPSRGHGYRDYGHSRRHESYSRGYRNHPSSRETRDYAPPHRDYAYRDYGHSSWD
EHSSRGYSYHDGYGEALGRDHSEHLSGSSYRDALQRYGTSHGAPPARGPRMSYGGSTCHA
YSNTRDRYGRSWESYSSCGDFHYCDREHVCRKDQRNPPSLGRVLPDPREACGSSSYVASI
VDGGESRSEKGDSSRY

Sequence length

496

Interactions

View interactions

Related Genes Genes most often co-reported with RBMY1C across shared curated disease and pathway associations. 0 Download as csv Download as pdf
No strongly related genes found yet for RBMY1C.

Diseases Linked via Similar Genes Diseases curated for genes most similar to RBMY1C (see Related Genes above), that are NOT already directly curated for RBMY1C itself -- a lead worth checking, not a confirmed association. 0 Download as csv Download as pdf
No additional diseases found yet through genes similar to RBMY1C.

RBMY1C (RNA binding motif protein Y-linked family 1 member C)

Bookmark This Gene