RBM24 (RNA binding motif protein 24)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Related genes Diseases linked via similar genes

Gene

• Entrez ID: 221662
• Gene name: RNA binding motif protein 24
• Gene symbol: RBM24
• Synonyms (NCBI Gene): RNPC6, dJ259A10.1
• Chromosome: 6
• Chromosome location: 6p22.3

miRNA Show/Hide all (135)

miRTarBase ID	miRNA	Experiments	Reference
MIRT021953	hsa-miR-128-3p	Microarray	17612493
MIRT022585	hsa-miR-124-3p	Microarray	18668037
MIRT496310	hsa-miR-148a-5p	PAR-CLIP	22291592
MIRT496309	hsa-miR-1245b-5p	PAR-CLIP	22291592
MIRT496307	hsa-miR-3142	PAR-CLIP	22291592
MIRT496308	hsa-miR-3168	PAR-CLIP	22291592
MIRT496306	hsa-miR-1295b-3p	PAR-CLIP	22291592
MIRT496310	hsa-miR-148a-5p	PAR-CLIP	22291592
MIRT496309	hsa-miR-1245b-5p	PAR-CLIP	22291592
MIRT496307	hsa-miR-3142	PAR-CLIP	22291592
MIRT496308	hsa-miR-3168	PAR-CLIP	22291592
MIRT496306	hsa-miR-1295b-3p	PAR-CLIP	22291592
MIRT1295465	hsa-miR-3977	CLIP-seq
MIRT1295466	hsa-miR-513b	CLIP-seq
MIRT1295467	hsa-miR-618	CLIP-seq
MIRT1295468	hsa-miR-1231	CLIP-seq
MIRT1295469	hsa-miR-1297	CLIP-seq
MIRT1295470	hsa-miR-208a	CLIP-seq
MIRT1295471	hsa-miR-208b	CLIP-seq
MIRT1295472	hsa-miR-2276	CLIP-seq
MIRT1295473	hsa-miR-26a	CLIP-seq
MIRT1295474	hsa-miR-26b	CLIP-seq
MIRT1295475	hsa-miR-3152-5p	CLIP-seq
MIRT1295476	hsa-miR-3163	CLIP-seq
MIRT1295477	hsa-miR-3617	CLIP-seq
MIRT1295478	hsa-miR-3692	CLIP-seq
MIRT1295465	hsa-miR-3977	CLIP-seq
MIRT1295479	hsa-miR-4277	CLIP-seq
MIRT1295480	hsa-miR-4288	CLIP-seq
MIRT1295481	hsa-miR-4465	CLIP-seq
MIRT1295482	hsa-miR-4668-3p	CLIP-seq
MIRT1295483	hsa-miR-4684-3p	CLIP-seq
MIRT1295484	hsa-miR-4763-5p	CLIP-seq
MIRT1295485	hsa-miR-4772-3p	CLIP-seq
MIRT1295486	hsa-miR-4774-3p	CLIP-seq
MIRT1295487	hsa-miR-494	CLIP-seq
MIRT1295488	hsa-miR-499-3p	CLIP-seq
MIRT1295489	hsa-miR-499-5p	CLIP-seq
MIRT1295490	hsa-miR-499a-3p	CLIP-seq
MIRT1295466	hsa-miR-513b	CLIP-seq
MIRT1295491	hsa-miR-544	CLIP-seq
MIRT1295492	hsa-miR-548c-3p	CLIP-seq
MIRT1295467	hsa-miR-618	CLIP-seq
MIRT1295493	hsa-miR-632	CLIP-seq
MIRT1295494	hsa-miR-641	CLIP-seq
MIRT1295495	hsa-miR-660	CLIP-seq
MIRT1295496	hsa-miR-664	CLIP-seq
MIRT1295465	hsa-miR-3977	CLIP-seq
MIRT1295466	hsa-miR-513b	CLIP-seq
MIRT1295467	hsa-miR-618	CLIP-seq
MIRT1295476	hsa-miR-3163	CLIP-seq
MIRT1295465	hsa-miR-3977	CLIP-seq
MIRT2087776	hsa-miR-4700-3p	CLIP-seq
MIRT1295466	hsa-miR-513b	CLIP-seq
MIRT1295492	hsa-miR-548c-3p	CLIP-seq
MIRT1295467	hsa-miR-618	CLIP-seq
MIRT1295465	hsa-miR-3977	CLIP-seq
MIRT1295466	hsa-miR-513b	CLIP-seq
MIRT1295467	hsa-miR-618	CLIP-seq
MIRT1295478	hsa-miR-3692	CLIP-seq
MIRT2439857	hsa-miR-103a	CLIP-seq
MIRT2439858	hsa-miR-106a	CLIP-seq
MIRT2439859	hsa-miR-106b	CLIP-seq
MIRT2439860	hsa-miR-107	CLIP-seq
MIRT2439861	hsa-miR-1303	CLIP-seq
MIRT2439862	hsa-miR-17	CLIP-seq
MIRT2439863	hsa-miR-20a	CLIP-seq
MIRT2439864	hsa-miR-20b	CLIP-seq
MIRT2439865	hsa-miR-3944-5p	CLIP-seq
MIRT2439866	hsa-miR-4509	CLIP-seq
MIRT2439867	hsa-miR-4744	CLIP-seq
MIRT2439868	hsa-miR-519d	CLIP-seq
MIRT2439869	hsa-miR-548a-3p	CLIP-seq
MIRT1295492	hsa-miR-548c-3p	CLIP-seq
MIRT2439870	hsa-miR-548e	CLIP-seq
MIRT2439871	hsa-miR-548f	CLIP-seq
MIRT2439872	hsa-miR-561	CLIP-seq
MIRT2439873	hsa-miR-93	CLIP-seq
MIRT2439857	hsa-miR-103a	CLIP-seq
MIRT2439858	hsa-miR-106a	CLIP-seq
MIRT2439859	hsa-miR-106b	CLIP-seq
MIRT2439860	hsa-miR-107	CLIP-seq
MIRT2439861	hsa-miR-1303	CLIP-seq
MIRT2439862	hsa-miR-17	CLIP-seq
MIRT2439863	hsa-miR-20a	CLIP-seq
MIRT2439864	hsa-miR-20b	CLIP-seq
MIRT2439865	hsa-miR-3944-5p	CLIP-seq
MIRT2439866	hsa-miR-4509	CLIP-seq
MIRT2439867	hsa-miR-4744	CLIP-seq
MIRT2439868	hsa-miR-519d	CLIP-seq
MIRT2439869	hsa-miR-548a-3p	CLIP-seq
MIRT1295492	hsa-miR-548c-3p	CLIP-seq
MIRT2439870	hsa-miR-548e	CLIP-seq
MIRT2439871	hsa-miR-548f	CLIP-seq
MIRT2439872	hsa-miR-561	CLIP-seq
MIRT2439873	hsa-miR-93	CLIP-seq
MIRT2609040	hsa-miR-1226	CLIP-seq
MIRT2609041	hsa-miR-148a	CLIP-seq
MIRT2609042	hsa-miR-148b	CLIP-seq
MIRT2609043	hsa-miR-152	CLIP-seq
MIRT2609044	hsa-miR-2392	CLIP-seq
MIRT2609045	hsa-miR-300	CLIP-seq
MIRT2609046	hsa-miR-3150a-3p	CLIP-seq
MIRT2609047	hsa-miR-3160-5p	CLIP-seq
MIRT2609048	hsa-miR-3175	CLIP-seq
MIRT2609049	hsa-miR-3662	CLIP-seq
MIRT2609050	hsa-miR-381	CLIP-seq
MIRT2609051	hsa-miR-4530	CLIP-seq
MIRT1295487	hsa-miR-494	CLIP-seq
MIRT2609052	hsa-miR-520f	CLIP-seq
MIRT1295492	hsa-miR-548c-3p	CLIP-seq
MIRT2609053	hsa-miR-634	CLIP-seq
MIRT2609054	hsa-miR-922	CLIP-seq
MIRT2609055	hsa-miR-939	CLIP-seq
MIRT2609056	hsa-miR-219-5p	CLIP-seq
MIRT1295478	hsa-miR-3692	CLIP-seq
MIRT2609057	hsa-miR-4782-3p	CLIP-seq
MIRT2609058	hsa-miR-508-3p	CLIP-seq
MIRT2609056	hsa-miR-219-5p	CLIP-seq
MIRT2609057	hsa-miR-4782-3p	CLIP-seq
MIRT2609058	hsa-miR-508-3p	CLIP-seq
MIRT2609040	hsa-miR-1226	CLIP-seq
MIRT2609044	hsa-miR-2392	CLIP-seq
MIRT2609045	hsa-miR-300	CLIP-seq
MIRT2609046	hsa-miR-3150a-3p	CLIP-seq
MIRT2609048	hsa-miR-3175	CLIP-seq
MIRT2609050	hsa-miR-381	CLIP-seq
MIRT2689441	hsa-miR-4501	CLIP-seq
MIRT2689442	hsa-miR-4504	CLIP-seq
MIRT2609051	hsa-miR-4530	CLIP-seq
MIRT1295487	hsa-miR-494	CLIP-seq
MIRT2689443	hsa-miR-542-3p	CLIP-seq
MIRT2609053	hsa-miR-634	CLIP-seq
MIRT2609054	hsa-miR-922	CLIP-seq
MIRT2609055	hsa-miR-939	CLIP-seq

Gene ontology (GO) Show/Hide all (44)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000381	Process	Regulation of alternative mRNA splicing, via spliceosome	IBA
GO:0000381	Process	Regulation of alternative mRNA splicing, via spliceosome	IEA
GO:0000381	Process	Regulation of alternative mRNA splicing, via spliceosome	IMP	26844700, 26990106, 29104163
GO:0000381	Process	Regulation of alternative mRNA splicing, via spliceosome	ISS
GO:0003197	Process	Endocardial cushion development	IEA
GO:0003676	Function	Nucleic acid binding	IEA
GO:0003723	Function	RNA binding	IEA
GO:0003730	Function	MRNA 3'-UTR binding	IBA
GO:0003730	Function	MRNA 3'-UTR binding	IDA	24375645, 29358667
GO:0003730	Function	MRNA 3'-UTR binding	IEA
GO:0003730	Function	MRNA 3'-UTR binding	ISS
GO:0005515	Function	Protein binding	IPI	29358667, 32296183
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IBA
GO:0005829	Component	Cytosol	IDA
GO:0006397	Process	MRNA processing	IEA
GO:0006417	Process	Regulation of translation	IEA
GO:0006974	Process	DNA damage response	IMP	24356969
GO:0008380	Process	RNA splicing	IEA
GO:0010830	Process	Regulation of myotube differentiation	IEA
GO:0010830	Process	Regulation of myotube differentiation	ISS
GO:0010831	Process	Positive regulation of myotube differentiation	IBA
GO:0010831	Process	Positive regulation of myotube differentiation	IMP	26844700
GO:0030154	Process	Cell differentiation	IEA
GO:0035925	Function	MRNA 3'-UTR AU-rich region binding	IDA	24356969
GO:0043488	Process	Regulation of mRNA stability	IEA
GO:0043488	Process	Regulation of mRNA stability	ISS
GO:0045663	Process	Positive regulation of myoblast differentiation	ISS
GO:0048255	Process	MRNA stabilization	IBA
GO:0048255	Process	MRNA stabilization	IMP	29104163
GO:0061157	Process	MRNA destabilization	IMP	29104163
GO:0061158	Process	3'-UTR-mediated mRNA destabilization	IDA	24375645
GO:0097157	Function	Pre-mRNA intronic binding	IEA
GO:0097157	Function	Pre-mRNA intronic binding	ISS
GO:1902811	Process	Positive regulation of skeletal muscle fiber differentiation	IEA
GO:1902811	Process	Positive regulation of skeletal muscle fiber differentiation	ISS
GO:1905870	Process	Positive regulation of 3'-UTR-mediated mRNA stabilization	IMP	24356969
GO:1990715	Function	MRNA CDS binding	IDA	29104163
GO:1990825	Function	Sequence-specific mRNA binding	IDA	29358667
GO:2000738	Process	Positive regulation of stem cell differentiation	IMP	26990106
GO:2000766	Process	Negative regulation of cytoplasmic translation	IMP	29358667

Other IDs

• MIM: 617603
• HGNC: 21539
• e!Ensembl: ENSG00000112183

Protein

• UniProt ID: Q9BX46
• Protein name: RNA-binding protein 24 (RNA-binding motif protein 24) (RNA-binding region-containing protein 6)
• Protein function: Multifunctional RNA-binding protein involved in the regulation of pre-mRNA splicing, mRNA stability and mRNA translation important for cell fate decision and differentiation (PubMed:20977548, PubMed:24375645, PubMed:29104163, PubMed:29358667). P
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00076	RRM_1	13 → 81	RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)	Domain

• Tissue specificity: TISSUE SPECIFICITY: Expressed in fetal and adult heart and skeletal muscles (PubMed:22345307, PubMed:25313962). {ECO:0000269|PubMed:22345307, ECO:0000269|PubMed:25313962}.
• Sequence:

  MHTTQKDTTYTKIFVGGLPYHTTDASLRKYFEVFGEIEEAVVITDRQTGKSRGYGFVTMA
  DRAAAERACKDPNPIIDGRKANVNLAYLGAKPRIMQPGFAFGVQQLHPALIQRPFGIPAH
  YVYPQAFVQPGVVIPHVQPTAAAASTTPYIDYTGAAYAQYSAAAAAAAAAAAYDQYPYAA
  SPAAAGYVTAGGYGYAVQQPITAAAPGTAAAAAAAAAAAAAFGQYQPQQLQTDRMQ

• Sequence length: 236

Related Genes

No strongly related genes found yet for RBM24.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to RBM24.