RBM15 (RNA binding motif protein 15)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Associated diseases Related genes Diseases linked via similar genes

Gene

• Entrez ID: 64783
• Gene name: RNA binding motif protein 15
• Gene symbol: RBM15
• Synonyms (NCBI Gene): OTT, OTT1, SPEN
• Chromosome: 1
• Chromosome location: 1p13.3
• Summary: Members of the SPEN (Split-end) family of proteins, including RBM15, have repressor function in several signaling pathways and may bind to RNA through interaction with spliceosome components (Hiriart et al., 2005 [PubMed 16129689]).[supplied by OMIM, Feb

miRNA Show/Hide all (48)

miRTarBase ID	miRNA	Experiments	Reference
MIRT1294975	hsa-miR-1236	CLIP-seq
MIRT1294976	hsa-miR-1256	CLIP-seq
MIRT1294977	hsa-miR-3177-5p	CLIP-seq
MIRT1294978	hsa-miR-339-3p	CLIP-seq
MIRT1294979	hsa-miR-3692	CLIP-seq
MIRT1294980	hsa-miR-4436b-5p	CLIP-seq
MIRT1294981	hsa-miR-4642	CLIP-seq
MIRT1294982	hsa-miR-4660	CLIP-seq
MIRT1294983	hsa-miR-4672	CLIP-seq
MIRT1294984	hsa-miR-4677-3p	CLIP-seq
MIRT1294985	hsa-miR-4719	CLIP-seq
MIRT1294986	hsa-miR-4731-3p	CLIP-seq
MIRT1294987	hsa-miR-4753-3p	CLIP-seq
MIRT1294988	hsa-miR-4801	CLIP-seq
MIRT1294989	hsa-miR-581	CLIP-seq
MIRT1294990	hsa-miR-583	CLIP-seq
MIRT1294991	hsa-miR-942	CLIP-seq
MIRT1294985	hsa-miR-4719	CLIP-seq
MIRT2312463	hsa-miR-22	CLIP-seq
MIRT2312464	hsa-miR-30a	CLIP-seq
MIRT2312465	hsa-miR-30b	CLIP-seq
MIRT2312466	hsa-miR-30c	CLIP-seq
MIRT2312467	hsa-miR-30d	CLIP-seq
MIRT2312468	hsa-miR-30e	CLIP-seq
MIRT2312469	hsa-miR-3160-5p	CLIP-seq
MIRT1294977	hsa-miR-3177-5p	CLIP-seq
MIRT2312470	hsa-miR-320e	CLIP-seq
MIRT2312471	hsa-miR-4257	CLIP-seq
MIRT2312472	hsa-miR-4495	CLIP-seq
MIRT2312473	hsa-miR-4503	CLIP-seq
MIRT2312474	hsa-miR-4641	CLIP-seq
MIRT2312475	hsa-miR-4659a-3p	CLIP-seq
MIRT2312476	hsa-miR-4659b-3p	CLIP-seq
MIRT1294983	hsa-miR-4672	CLIP-seq
MIRT1294985	hsa-miR-4719	CLIP-seq
MIRT1294986	hsa-miR-4731-3p	CLIP-seq
MIRT2312477	hsa-miR-4769-3p	CLIP-seq
MIRT1294988	hsa-miR-4801	CLIP-seq
MIRT1294989	hsa-miR-581	CLIP-seq
MIRT1294977	hsa-miR-3177-5p	CLIP-seq
MIRT1294979	hsa-miR-3692	CLIP-seq
MIRT1294980	hsa-miR-4436b-5p	CLIP-seq
MIRT1294983	hsa-miR-4672	CLIP-seq
MIRT1294985	hsa-miR-4719	CLIP-seq
MIRT1294990	hsa-miR-583	CLIP-seq
MIRT1294979	hsa-miR-3692	CLIP-seq
MIRT1294980	hsa-miR-4436b-5p	CLIP-seq
MIRT1294990	hsa-miR-583	CLIP-seq

Gene ontology (GO) Show/Hide all (36)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000381	Process	Regulation of alternative mRNA splicing, via spliceosome	IBA
GO:0000381	Process	Regulation of alternative mRNA splicing, via spliceosome	IDA	26575292
GO:0000381	Process	Regulation of alternative mRNA splicing, via spliceosome	IEA
GO:0001510	Process	RNA methylation	IDA	27602518
GO:0001510	Process	RNA methylation	IEA
GO:0001569	Process	Branching involved in blood vessel morphogenesis	IEA
GO:0003676	Function	Nucleic acid binding	IEA
GO:0003723	Function	RNA binding	HDA	22658674, 22681889
GO:0003723	Function	RNA binding	IDA	27602518
GO:0003723	Function	RNA binding	IEA
GO:0003729	Function	MRNA binding	IBA
GO:0003729	Function	MRNA binding	IDA	26575292
GO:0005515	Function	Protein binding	IPI	16129689, 25416956, 26575292, 32296183
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005635	Component	Nuclear envelope	IEA
GO:0005654	Component	Nucleoplasm	IDA	24100041
GO:0005654	Component	Nucleoplasm	IEA
GO:0007221	Process	Positive regulation of transcription of Notch receptor target	IEA
GO:0009048	Process	Dosage compensation by inactivation of X chromosome	IDA	27602518
GO:0009048	Process	Dosage compensation by inactivation of X chromosome	IEA
GO:0016020	Component	Membrane	IEA
GO:0016607	Component	Nuclear speck	IDA	24100041
GO:0016607	Component	Nuclear speck	IEA
GO:0031965	Component	Nuclear membrane	IEA
GO:0036396	Component	RNA N6-methyladenosine methyltransferase complex	IDA	27602518
GO:0036396	Component	RNA N6-methyladenosine methyltransferase complex	IEA
GO:0038163	Process	Thrombopoietin-mediated signaling pathway	IEA
GO:0038163	Process	Thrombopoietin-mediated signaling pathway	ISS
GO:0045637	Process	Regulation of myeloid cell differentiation	IEA
GO:0045638	Process	Negative regulation of myeloid cell differentiation	IEA
GO:0045652	Process	Regulation of megakaryocyte differentiation	IDA	26575292
GO:0045892	Process	Negative regulation of DNA-templated transcription	IDA	16129689
GO:0048536	Process	Spleen development	IEA
GO:0060412	Process	Ventricular septum morphogenesis	IEA
GO:0060674	Process	Placenta blood vessel development	IEA

Other IDs

• MIM: 606077
• HGNC: 14959
• e!Ensembl: ENSG00000162775

Protein

• UniProt ID: Q96T37
• Protein name: RNA-binding protein 15 (One-twenty two protein 1) (RNA-binding motif protein 15)
• Protein function: RNA-binding protein that acts as a key regulator of N6-methyladenosine (m6A) methylation of RNAs, thereby regulating different processes, such as hematopoietic cell homeostasis, alternative splicing of mRNAs and X chromosome inactivation mediate
• PDB: 7Z27
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00076	RRM_1	376 → 445	RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)	Domain
  PF00076	RRM_1	179 → 246	RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)	Domain
  PF07744	SPOC	778 → 955	SPOC domain	Domain

• Sequence:

  MRTAGRDPVPRRSPRWRRAVPLCETSAGRRVTQLRGDDLRRPATMKGKERSPVKAKRSRG
  GEDSTSRGERSKKLGGSGGSNGSSSGKTDSGGGSRRSLHLDKSSSRGGSREYDTGGGSSS
  SRLHSYSSPSTKNSSGGGESRSSSRGGGGESRSSGAASSAPGGGDGAEYKTLKISELGSQ
  LSDEAVEDGLFHEFKRFGDVSVKISHLSGSGSGDERVAFVNFRRPEDARAAKHARGRLVL
  YDRPLKIEAVYVSRRRSRSPLDKDTYPPSASVVGASVGGHRHPPGGGGGQRSLSPGGAAL
  GYRDYRLQQLALGRLPPPPPPPLPRDLERERDYPFYERVRPAYSLEPRVGAGAGAAPFRE
  VDEISPEDDQRANRTLFLGNLDITVTESDLRRAFDRFGVITEVDIKRPSRGQTSTYGFLK
  FENLDMSHRAKLAMSGKIIIRNPIKIGYGKATPTTRLWVGGLGPWVPLAALAREFDRFGT
  IRTIDYRKGDSWAYIQYESLDAAHAAWTHMRGFPLGGPDRRLRVDFADTEHRYQQQYLQP
  LPLTHYELVTDAFGHRAPDPLRGARDRTPPLLYRDRDRDLYPDSDWVPPPPPVRERSTRT
  AATSVPAYEPLDSLDRRRDGWSLDRDRGDRDLPSSRDQPRKRRLPEESGGRHLDRSPESD
  RPRKRHCAPSPDRSPELSSSRDRYNSDNDRSSRLLLERPSPIRDRRGSLEKSQGDKRDRK
  NSASAERDRKHRTTAPTEGKSPLKKEDRSDGSAPSTSTASSKLKSPSQKQDGGTAPVASA
  SPKLCLAWQGMLLLKNSNFPSNMHLLQGDLQVASSLLVEGSTGGKVAQLKITQRLRLDQP
  KLDEVTRRIKVAGPNGYAILLAVPGSSDSRSSSSSAASDTATSTQRPLRNLVSYLKQKQA
  AGVISLPVGGNKDKENTGVLHAFPPCEFSQQFLDSPAKALAKSEEDYLVMIIVRGFGFQI
  GVRYENKKRENLALTLL

• Sequence length: 977

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Neuroblastoma	other	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining Show/Hide Text Mining Associations (88)
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute leukemia	Leukemia	BEFREE	11344311		★☆☆☆☆ Found in Text Mining only
Acute Megakaryocytic Leukemias	Megakaryocytic Leukemia	BEFREE	11344311, 11431691, 15561678, 18667423, 19287095, 21370421, 22469944, 22497198, 29427526		★☆☆☆☆ Found in Text Mining only
Acute Megakaryocytic Leukemias	Megakaryocytic Leukemia	LHGDN	18667423		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma, Endometrioid	Endometrial Cancer	BEFREE	17234755		★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	17234755		★☆☆☆☆ Found in Text Mining only
Adenomatous Polyposis Coli	Multiple polyposis syndrome	BEFREE	18451217		★☆☆☆☆ Found in Text Mining only
Adrenocortical Carcinoma	Adrenocortical carcinoma	Pubtator	33725886	Associate	★☆☆☆☆ Found in Text Mining only
Adult Acute Myeloblastic Leukemia	Myeloblastic Leukemia	BEFREE	15849773		★☆☆☆☆ Found in Text Mining only
Agenesis of corpus callosum	Agenesis Of Corpus Callosum	BEFREE	23778141		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	22355143	Associate	★☆☆☆☆ Found in Text Mining only
Aplasia Cutis Congenita	Aplasia Cutis Congenita	BEFREE	23778141		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	23457522		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	35606385	Associate	★☆☆☆☆ Found in Text Mining only
Attention Deficit Disorder with Hyperactivity	Attention deficit hyperactivity disorder	Pubtator	33596411	Associate	★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorder	Autism	Pubtator	33596411	Associate	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	32641685	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	37474926, 37620924	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	17234755		★☆☆☆☆ Found in Text Mining only
Carcinoma Adenoid Cystic	Adenoid cystic carcinoma	Pubtator	23778135, 23778141	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	32631107, 34221187	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	34288818	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	38164857	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Endometrioid	Endometrioid cancer	LHGDN	17234755		★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	Pubtator	37041267	Associate	★☆☆☆☆ Found in Text Mining only
Cardiovascular Abnormalities	Cardiovascular abnormalities	Pubtator	24454898	Associate	★☆☆☆☆ Found in Text Mining only
Cerebral Small Vessel Diseases	Cerebral Microangiopathy	BEFREE	30830567		★☆☆☆☆ Found in Text Mining only
Chromosome 1p36 Deletion Syndrome	Chromosome 1p36 deletion syndrome	Pubtator	33596411	Inhibit	★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	BEFREE	18767147		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	31823961	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	12414620, 17474983		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	32641685, 33415160	Associate	★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	36595818	Associate	★☆☆☆☆ Found in Text Mining only
Developmental Disabilities	Developmental disability	Pubtator	33004838, 33596411	Associate	★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	CGI_DG			★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	34432221	Associate	★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic Neoplasms	BEFREE	22497198		★☆☆☆☆ Found in Text Mining only
Hereditary Nonpolyposis Colorectal Cancer	Colorectal Cancer	BEFREE	15340260		★☆☆☆☆ Found in Text Mining only
Histiocytosis haematophagic	Histiocytosis Haematophagic	BEFREE	22469944		★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington disease	Pubtator	33049985	Associate	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	40682199	Associate	★☆☆☆☆ Found in Text Mining only
Kaposi Sarcoma	Kaposi Sarcoma	BEFREE	25690794		★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	15561678, 18667423		★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	18667423	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	15849773	Associate	★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	19787262, 22407776, 28299600, 29190996, 29943624, 30809080		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	24954872		★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin	Non-Hodgkin lymphoma	CGI_DG			★☆☆☆☆ Found in Text Mining only
Lymphoproliferative Disorders	Lymphoproliferative syndrome	Pubtator	37705050	Associate	★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	UNIPROT_DG			★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	CTD_human_DG	29610475		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	31786881		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	17079487		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	15561678, 23778141, 24954872		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	26297734		★☆☆☆☆ Found in Text Mining only
Megakaryoblastic acute myeloid leukemia with t(1;22)(p13;q13)	Megakaryoblastic Acute Myeloid Leukemia With T(1;22)(P13;Q13)	ORPHANET_DG	19357394		★☆☆☆☆ Found in Text Mining only
Megakaryoblastic acute myeloid leukemia with t(1;22)(p13;q13)	Megakaryoblastic Acute Myeloid Leukemia With T(1;22)(P13;Q13)	Orphanet			★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	21081840, 30662871		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	25743686	Associate	★☆☆☆☆ Found in Text Mining only
Myasthenia Gravis	Myasthenia gravis	Pubtator	36864526	Stimulate	★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia	Myeloid Leukemia	BEFREE	22469944		★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	22497198		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial infarction	Pubtator	36061306	Associate	★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial infarction	Pubtator	40682199	Stimulate	★☆☆☆☆ Found in Text Mining only
Myotonic Dystrophy	Myotonic dystrophy	BEFREE	21637295		★☆☆☆☆ Found in Text Mining only
Myotonic Dystrophy	Myotonic dystrophy	Pubtator	21637295	Associate	★☆☆☆☆ Found in Text Mining only
MYOTONIC DYSTROPHY 1	Myotonic dystrophy	BEFREE	21637295		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	32641685	Stimulate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	17079487, 18765545, 31574418		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	17079487		★☆☆☆☆ Found in Text Mining only
Nonorganic psychosis	Nonorganic Psychosis	BEFREE	31451124		★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	Pubtator	36967763	Associate	★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	36181462, 37002245	Associate	★☆☆☆☆ Found in Text Mining only
Ovarian Diseases	Ovarian diseases	Pubtator	37594126	Associate	★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	32641685, 33225598, 37594126	Associate	★☆☆☆☆ Found in Text Mining only
Phyllodes Tumor	Phyllodes Tumor	BEFREE	29315289		★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	37046273	Associate	★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	31786881		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	CTD_human_DG	29610475		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	29610475	Associate	★☆☆☆☆ Found in Text Mining only
Pseudohyperkalemia Cardiff	Pseudohyperkalemia Cardiff	BEFREE	22407776		★☆☆☆☆ Found in Text Mining only
Psychotic Disorders	Psychosis	BEFREE	31451124		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	18765545		★☆☆☆☆ Found in Text Mining only
Salivary Gland Neoplasms	Salivary gland neoplasm	CGI_DG			★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	Pubtator	33370249	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoma Kaposi	Sarcoma	Pubtator	20828777	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	36389678	Associate	★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	38049758	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	37474926	Associate	★☆☆☆☆ Found in Text Mining only

Related Genes

No strongly related genes found yet for RBM15.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to RBM15.