RBM11 (RNA binding motif protein 11)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Related genes Diseases linked via similar genes

Gene

• Entrez ID: 54033
• Gene name: RNA binding motif protein 11
• Gene symbol: RBM11
• Synonyms (NCBI Gene): -
• Chromosome: 21
• Chromosome location: 21q11.2

miRNA Show/Hide all (9)

miRTarBase ID	miRNA	Experiments	Reference
MIRT2087547	hsa-miR-3146	CLIP-seq
MIRT2312409	hsa-miR-3121-5p	CLIP-seq
MIRT2312410	hsa-miR-3124-3p	CLIP-seq
MIRT2312411	hsa-miR-4528	CLIP-seq
MIRT2312412	hsa-miR-9	CLIP-seq
MIRT2457858	hsa-miR-365	CLIP-seq
MIRT2457859	hsa-miR-610	CLIP-seq
MIRT2457858	hsa-miR-365	CLIP-seq
MIRT2457859	hsa-miR-610	CLIP-seq

Gene ontology (GO) Show/Hide all (20)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000381	Process	Regulation of alternative mRNA splicing, via spliceosome	IBA
GO:0000381	Process	Regulation of alternative mRNA splicing, via spliceosome	IDA	21984414
GO:0003676	Function	Nucleic acid binding	IEA
GO:0003723	Function	RNA binding	IEA
GO:0003727	Function	Single-stranded RNA binding	IBA
GO:0005515	Function	Protein binding	IPI	25416956, 28514442, 32296183, 32814053, 33961781, 35914814
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	21984414
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA	21984414
GO:0005654	Component	Nucleoplasm	IEA
GO:0006397	Process	MRNA processing	IEA
GO:0008266	Function	Poly(U) RNA binding	IDA	21984414
GO:0008266	Function	Poly(U) RNA binding	IEA
GO:0008380	Process	RNA splicing	IEA
GO:0016607	Component	Nuclear speck	IDA	21984414
GO:0016607	Component	Nuclear speck	IEA
GO:0030154	Process	Cell differentiation	IEA
GO:0034599	Process	Cellular response to oxidative stress	IDA	21984414
GO:0042803	Function	Protein homodimerization activity	IDA	21984414

Other IDs

• MIM: 617937
• HGNC: 9897
• e!Ensembl: ENSG00000185272

Protein

• UniProt ID: P57052
• Protein name: Splicing regulator RBM11 (RNA-binding motif protein 11)
• Protein function: Tissue-specific splicing factor with potential implication in the regulation of alternative splicing during neuron and germ cell differentiation. Antagonizes SRSF1-mediated BCL-X splicing. May affect the choice of alternative 5' splice sites by
• PDB: 2YWK
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00076	RRM_1	12 → 81	RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)	Domain

• Tissue specificity: TISSUE SPECIFICITY: Expressed in brain, hippocampus, prefrontal cortex, cerebellum, spinal cord, testis, mammary gland, spleen and kidney. Also expressed in fetal brain. {ECO:0000269|PubMed:12036298, ECO:0000269|PubMed:12909339, ECO:0000269|PubMed:2198441
• Sequence:

  MFPAQEEADRTVFVGNLEARVREEILYELFLQAGPLTKVTICKDREGKPKSFGFVCFKHP
  ESVSYAIALLNGIRLYGRPINVQYRFGSSRSSEPANQSFESCVKINSHNYRNEEMLVGRS
  SFPMQYFPINNTSLPQEYFLFQKMQWHVYNPVLQLPYYEMTAPLPNSASVSSSLNHVPDL
  EAGPSSYKWTHQQPSDSDLYQMTAPLPNSASVSSSLNHVPDLEAGPSSYKWTHQQPSDSD
  LYQMNKRKRQKQTSDSDSSTDNNRGNECSQKFRKSKKKKRY

• Sequence length: 281

Related Genes

No strongly related genes found yet for RBM11.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to RBM11.