RBM10 (RNA binding motif protein 10)

Download as csv Download as pdf

Log in to save this analysis

Save This Analysis

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene SNPs miRNA Gene ontology Other IDs Protein Associated diseases Diseases linked via similar genes

Gene

• Entrez ID: 8241
• Gene name: RNA binding motif protein 10
• Gene symbol: RBM10
• Synonyms (NCBI Gene): DXS8237E, GPATC9, GPATCH9, MINAS-60, S1-1, TARPS, ZRANB5
• Chromosome: X
• Chromosome location: Xp11.3
• Summary: This gene encodes a nuclear protein that belongs to a family proteins that contain an RNA-binding motif. The encoded protein associates with hnRNP proteins and may be involved in regulating alternative splicing. Defects in this gene are the cause of the X

SNPs Show/Hide all (16)

SNP ID	Visualize variation	Clinical significance	Consequence
rs149109733	A>G	Conflicting-interpretations-of-pathogenicity	Synonymous variant, coding sequence variant
rs267607000	G>A	Pathogenic	Coding sequence variant, stop gained
rs886041461	AT>-	Pathogenic	Stop gained, 5 prime UTR variant, coding sequence variant, genic upstream transcript variant
rs886041742	->T	Pathogenic	Splice donor variant
rs886044715	->A	Pathogenic	Frameshift variant, coding sequence variant
rs886044718	C>T	Pathogenic	Stop gained, 5 prime UTR variant, coding sequence variant, genic upstream transcript variant
rs1064795088	A>-	Likely-pathogenic	Intron variant
rs1131690789	AG>-	Pathogenic	Frameshift variant, coding sequence variant
rs1131691421	TGAG>-	Pathogenic	Frameshift variant, coding sequence variant
rs1556770954	C>-	Pathogenic	Genic upstream transcript variant, 5 prime UTR variant, coding sequence variant, frameshift variant
rs1556778986	G>A	Pathogenic	Splice acceptor variant
rs1556779417	GT>-	Pathogenic	Frameshift variant, coding sequence variant
rs1556782770	A>G	Likely-pathogenic	Splice acceptor variant
rs1602556716	GAGG>-	Likely-pathogenic	Coding sequence variant, 5 prime UTR variant, intron variant, genic upstream transcript variant, frameshift variant
rs1602582207	G>-	Pathogenic	Coding sequence variant, genic upstream transcript variant, upstream transcript variant, frameshift variant
rs1602582334	T>C	Pathogenic	Genic upstream transcript variant, splice donor variant, upstream transcript variant

miRNA Show/Hide all (15)

miRTarBase ID	miRNA	Experiments	Reference
MIRT049482	hsa-miR-92a-3p	qRT-PCR	23622248
MIRT050535	hsa-miR-20a-5p	CLASH	23622248
MIRT049482	hsa-miR-92a-3p	CLASH	23622248
MIRT046742	hsa-miR-222-3p	CLASH	23622248
MIRT045311	hsa-miR-186-5p	CLASH	23622248
MIRT042904	hsa-miR-324-3p	CLASH	23622248
MIRT040646	hsa-miR-92b-3p	CLASH	23622248
MIRT039700	hsa-miR-615-3p	CLASH	23622248
MIRT039700	hsa-miR-615-3p	CLASH	23622248
MIRT039700	hsa-miR-615-3p	CLASH	23622248
MIRT036471	hsa-miR-1226-3p	CLASH	23622248
MIRT1294517	hsa-miR-4700-3p	CLIP-seq
MIRT1294518	hsa-miR-520d-5p	CLIP-seq
MIRT1294519	hsa-miR-524-5p	CLIP-seq
MIRT1294520	hsa-miR-556-3p	CLIP-seq

Gene ontology (GO) Show/Hide all (30)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0000398	Process	MRNA splicing, via spliceosome	IBA
GO:0003676	Function	Nucleic acid binding	IEA
GO:0003723	Function	RNA binding	HDA	22658674
GO:0003723	Function	RNA binding	IBA
GO:0003723	Function	RNA binding	IEA
GO:0005515	Function	Protein binding	IPI	22365833, 25416956, 26871637, 29021621, 32296183, 32814053, 35271311, 35393574
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	28091594
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005730	Component	Nucleolus	IDA	35393574
GO:0005730	Component	Nucleolus	IEA
GO:0006397	Process	MRNA processing	IEA
GO:0008270	Function	Zinc ion binding	IEA
GO:0008285	Process	Negative regulation of cell population proliferation	IEA
GO:0008380	Process	RNA splicing	IEA
GO:0016607	Component	Nuclear speck	IDA
GO:0032991	Component	Protein-containing complex	IPI	17707232
GO:0035198	Function	MiRNA binding	IDA	28431233
GO:0042802	Function	Identical protein binding	IPI	22365833
GO:0046872	Function	Metal ion binding	IEA
GO:0048025	Process	Negative regulation of mRNA splicing, via spliceosome	IEA
GO:0070935	Process	3'-UTR-mediated mRNA stabilization	IEA
GO:1904706	Process	Negative regulation of vascular associated smooth muscle cell proliferation	IEA
GO:1905288	Process	Vascular associated smooth muscle cell apoptotic process	IEA
GO:1905459	Process	Regulation of vascular associated smooth muscle cell apoptotic process	IEA
GO:1905461	Process	Positive regulation of vascular associated smooth muscle cell apoptotic process	IEA
GO:1990874	Process	Vascular associated smooth muscle cell proliferation	IEA
GO:2000204	Process	Negative regulation of ribosomal large subunit export from nucleus	IDA	35393574

Other IDs

• MIM: 300080
• HGNC: 9896
• e!Ensembl: ENSG00000182872

Protein

• UniProt ID: P98175
• Protein name: RNA-binding protein 10 (G patch domain-containing protein 9) (RNA-binding motif protein 10) (RNA-binding protein S1-1) (S1-1)
• Protein function: Binds to ssRNA containing the consensus sequence 5'-AGGUAA-3' (PubMed:21256132). May be involved in post-transcriptional processing, most probably in mRNA splicing (PubMed:18315527). Binds to RNA homopolymers, with a preference for poly(G) and p
• PDB: 2LXI , 2M2B , 2MXV , 2MXW , 5ZSW , 5ZSY
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00076	RRM_1	131 → 202	RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)	Domain
  PF00641	zf-RanBP	214 → 242	Zn-finger in Ran binding protein and others	Domain
  PF01585	G-patch	858 → 902	G-patch domain	Family
  PF17780	OCRE	568 → 619	OCRE domain	Domain

• Sequence:

  MEYERRGGRGDRTGRYGATDRSQDDGGENRSRDHDYRDMDYRSYPREYGSQEGKHDYDDS
  SEEQSAEDSYEASPGSETQRRRRRRHRHSPTGPPGFPRDGDYRDQDYRTEQGEEEEEEED
  EEEEEKASNIVMLRMLPQAATEDDIRGQLQSHGVQAREVRLMRNKSSGQSRGFAFVEFSH
  LQDATRWMEANQHSLNILGQKVSMHYSDPKPKINEDWLCNKCGVQNFKRREKCFKCGVPK
  SEAEQKLPLGTRLDQQTLPLGGRELSQGLLPLPQPYQAQGVLASQALSQGSEPSSENAND
  TIILRNLNPHSTMDSILGALAPYAVLSSSNVRVIKDKQTQLNRGFAFIQLSTIVEAAQLL
  QILQALHPPLTIDGKTINVEFAKGSKRDMASNEGSRISAASVASTAIAAAQWAISQASQG
  GEGTWATSEEPPVDYSYYQQDEGYGNSQGTESSLYAHGYLKGTKGPGITGTKGDPTGAGP
  EASLEPGADSVSMQAFSRAQPGAAPGIYQQSAEASSSQGTAANSQSYTIMSPAVLKSELQ
  SPTHPSSALPPATSPTAQESYSQYPVPDVSTYQYDETSGYYYDPQTGLYYDPNSQYYYNA
  QSQQYLYWDGERRTYVPALEQSADGHKETGAPSKEGKEKKEKHKTKTAQQIAKDMERWAR
  SLNKQKENFKNSFQPISSLRDDERRESATADAGYAILEKKGALAERQHTSMDLPKLASDD
  RPSPPRGLVAAYSGESDSEEEQERGGPEREEKLTDWQKLACLLCRRQFPSKEALIRHQQL
  SGLHKQNLEIHRRAHLSENELEALEKNDMEQMKYRDRAAERREKYGIPEPPEPKRRKYGG
  ISTASVDFEQPTRDGLGSDNIGSRMLQAMGWKEGSGLGRKKQGIVTPIEAQTRVRGSGLG
  ARGSSYGVTSTESYKETLHKTMVTRFNEAQ

• Sequence length: 930
• UniProt ID: P0DW28
• Protein name: Ribosome biogenesis inhibitor MINAS-60 (MINAS-60)
• Protein function: Acts as a late-stage inhibitor of pre-60S ribosome assembly by preventing pre-60S ribosome export from nucleus.
• Sequence:

  MEYERRGGRGDRTGRYGATDRSQDDGGENRSRDHDYRDMDYRSYPREYGSQEGKHDYDDS
  SEEQSAEDSYEASPGSETQRRRRRRHRHSPTGPPGFPRDGDYRDQDYRTEQGEEEEEEED
  EEEEEKASNIVMLRMLPQAATEDDIRGQLQSHGVQAREVRLMRNKSSGQSRGFAFVEFSH
  LQDATRWMEANQHSLNILGQKVSMHYSDPKPKINEDWLCNKCGVQNFKRREKCFKCGVPK
  SEAEQKLPLGTRLDQQTLPLGGRELSQGLLPLPQPYQAQGVLASQALSQGSEPSSENAND
  TIILRNLNPHSTMDSILGALAPYAVLSSSNVRVIKDKQTQLNRGFAFIQLSTIVEAAQLL
  QILQALHPPLTIDGKTINVEFAKGSKRDMASNEGSRISAASVASTAIAAAQWAISQASQG
  GEGTWATSEEPPVDYSYYQQDEGYGNSQGTESSLYAHGYLKGTKGPGITGTKGDPTGAGP
  EASLEPGADSVSMQAFSRAQPGAAPGIYQQSAEASSSQGTAANSQSYTIMSPAVLKSELQ
  SPTHPSSALPPATSPTAQESYSQYPVPDVSTYQYDETSGYYYDPQTGLYYDPNSQYYYNA
  QSQQYLYWDGERRTYVPALEQSADGHKETGAPSKEGKEKKEKHKTKTAQQIAKDMERWAR
  SLNKQKENFKNSFQPISSLRDDERRESATADAGYAILEKKGALAERQHTSMDLPKLASDD
  RPSPPRGLVAAYSGESDSEEEQERGGPEREEKLTDWQKLACLLCRRQFPSKEALIRHQQL
  SGLHKQNLEIHRRAHLSENELEALEKNDMEQMKYRDRAAERREKYGIPEPPEPKRRKYGG
  ISTASVDFEQPTRDGLGSDNIGSRMLQAMGWKEGSGLGRKKQGIVTPIEAQTRVRGSGLG
  ARGSSYGVTSTESYKETLHKTMVTRFNEAQ

• Sequence length: 930

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Causal Show/Hide Causal Diseases (6)
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Malignant tumor of urinary bladder	Likely pathogenic	rs2147220533	RCV005932762	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Nephroblastoma	Pathogenic	rs1131691421	RCV006254074	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Neurodevelopmental delay	Pathogenic	rs1556772860	RCV002274404	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Nonpapillary renal cell carcinoma	Likely pathogenic; Pathogenic	rs2147220533, rs1602582334	RCV005932763 RCV005906932	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
RBM10-related disorder	Likely pathogenic	rs2147220533	RCV003414240	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
TARP syndrome	Pathogenic; Likely pathogenic	rs375207660, rs781920661, rs886044718, rs1556782020, rs2147136759, rs1556772860, rs2521133928, rs2147209967, rs1934631873, rs886044715, rs267607000, rs2147211835, rs2520715667, rs1556770954, rs1556778986, rs1602582334, rs1935843757, rs1934642808, rs1935600115, rs1934470534	RCV001784904 RCV001808163 RCV000125462 RCV003096092 RCV002273081 RCV004594639 RCV002470388 RCV002470542 RCV003123453 RCV000012409 RCV000012410 RCV003455834 RCV004595067 RCV000497747 RCV000503825 RCV000850592 RCV002464383 RCV001253313 RCV001255137 RCV001267658	★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Hearing impairment	Conflicting classifications of pathogenicity	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatocellular carcinoma	Uncertain significance	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Intellectual disability	Benign; Likely benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of esophagus	Likely benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Likely benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining Show/Hide Text Mining Associations (83)
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adenocarcinoma	Adenocarcinoma	BEFREE	29085465		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	28091594, 28586478, 30405763, 30483773, 30803556, 30955253		★☆☆☆☆ Found in Text Mining only
Ameloblastoma	Ameloblastoma	BEFREE	30803556		★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	BEFREE	23673116		★☆☆☆☆ Found in Text Mining only
Athetoid cerebral palsy	Athetoid cerebral palsy	HPO_DG			★☆☆☆☆ Found in Text Mining only
Atrial Septal Defects	Atrial Septal Defect	HPO_DG			★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	Pubtator	36944446	Associate	★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	16552754, 18820371, 21737612, 30803556		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	18820371	Associate	★☆☆☆☆ Found in Text Mining only
Byzanthine arch palate	High palate	HPO_DG			★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	31820547, 38032932	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	32572914	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	24332178, 29085465, 30483773		★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	25855536	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	28296677, 32251007, 33854184, 35231161	Associate	★☆☆☆☆ Found in Text Mining only
Cerebellar Hypoplasia	Cerebellar Hypoplasia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Clinodactyly	Clinodactyly	HPO_DG			★☆☆☆☆ Found in Text Mining only
Clinodactyly of fingers	Clinodactyly	HPO_DG			★☆☆☆☆ Found in Text Mining only
Clubfoot	Clubfoot	Pubtator	24259342, 28577551, 36944446	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	UNIPROT_DG			★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	37146911	Inhibit	★☆☆☆☆ Found in Text Mining only
Congenital Abnormalities	Congenital abnormalities	Pubtator	24000153	Associate	★☆☆☆☆ Found in Text Mining only
Congenital clubfoot	Congenital Clubfoot	BEFREE	27395407, 28577551		★☆☆☆☆ Found in Text Mining only
Congenital clubfoot	Congenital Clubfoot	HPO_DG			★☆☆☆☆ Found in Text Mining only
Congenital hypoplasia of lung	Pulmonary hypoplasia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Congenital hypoplasia of radius	Congenital Hypoplasia Of Radius	HPO_DG			★☆☆☆☆ Found in Text Mining only
Congenital pectus excavatum	Congenital Pectus Excavatum	HPO_DG			★☆☆☆☆ Found in Text Mining only
Congenital small ears	Microtia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	30257214		★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	26998913, 28296677, 30908700		★☆☆☆☆ Found in Text Mining only
Cryptorchidism	Cryptorchidism	HPO_DG			★☆☆☆☆ Found in Text Mining only
Dysmorphic features	Dysmorphic Features	CLINVAR_DG	20451169, 21910224, 24259342, 24530524, 28577551, 5410571		★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	31587503		★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	31587503	Associate	★☆☆☆☆ Found in Text Mining only
Esotropia	Esotropia	Pubtator	30462380	Associate	★☆☆☆☆ Found in Text Mining only
Global developmental delay	Developmental Delay	HPO_DG			★☆☆☆☆ Found in Text Mining only
Glossoptosis	Glossoptosis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	30257214		★☆☆☆☆ Found in Text Mining only
Heart Septal Defects Atrial	Congenital heart septal defect	Pubtator	24259342, 28577551, 36944446	Associate	★☆☆☆☆ Found in Text Mining only
Horseshoe Kidney	Horseshoe Kidney	HPO_DG			★☆☆☆☆ Found in Text Mining only
Hydronephrosis	Hydronephrosis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Intellectual developmental disorder	Pubtator	21910224	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Intellectual Disability	Mental retardation	HPO_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung Neoplasms	Lung neoplasms	Pubtator	25889998, 28662214, 33407425, 34887263, 35579943, 38032932	Associate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	29085465		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	38032932	Inhibit	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	32572914	Associate	★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	16552754, 18820371, 30803556		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	31587503		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	24332178, 28662214, 29085465, 30483773		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	28091594, 28379442, 28728573, 31591476		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	16552754, 18820371		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	26751795	Associate	★☆☆☆☆ Found in Text Mining only
Micrognathism	Micrognathism	HPO_DG			★☆☆☆☆ Found in Text Mining only
Multiple congenital anomalies	Multiple Congenital Anomalies	CLINVAR_DG	20451169, 21910224, 24259342, 24530524, 28577551, 5410571		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	35905688	Associate	★☆☆☆☆ Found in Text Mining only
Myopia	Myopia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	16552754, 28091594, 29085465, 29274279, 30483773, 30803556, 31587503, 31591476		★☆☆☆☆ Found in Text Mining only
Optic Atrophy	Optic atrophy	Pubtator	21910224	Associate	★☆☆☆☆ Found in Text Mining only
Optic Atrophy	Optic Atrophy	HPO_DG			★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	30403180	Inhibit	★☆☆☆☆ Found in Text Mining only
Persistent left superior vena cava	Persistent left superior vena cava	BEFREE	24259342		★☆☆☆☆ Found in Text Mining only
Persistent left superior vena cava	Persistent left superior vena cava	HPO_DG			★☆☆☆☆ Found in Text Mining only
Pierre Robin Syndrome	Pierre-Robin Syndrome	HPO_DG			★☆☆☆☆ Found in Text Mining only
Polydactyly	Polydactyly	GENOMICS_ENGLAND_DG	24259342		★☆☆☆☆ Found in Text Mining only
POLYDACTYLY, POSTAXIAL	Polydactyly	HPO_DG			★☆☆☆☆ Found in Text Mining only
Posteriorly rotated ear	Posteriorly Rotated Ear	HPO_DG			★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	26998913, 28288037, 28296677, 30908700		★☆☆☆☆ Found in Text Mining only
Scoliosis, unspecified	Scoliosis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	BEFREE	28662214		★☆☆☆☆ Found in Text Mining only
Small Cell Lung Carcinoma	Small cell lung carcinoma	Pubtator	28662214	Associate	★☆☆☆☆ Found in Text Mining only
Syndactyly of fingers	Syndactyly of fingers	HPO_DG			★☆☆☆☆ Found in Text Mining only
TARP syndrome	TARP Syndrome	GENOMICS_ENGLAND_DG	20451169, 24259342, 5410571		★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
TARP syndrome	TARP Syndrome	CLINVAR_DG	20451169, 21910224		★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
TARP syndrome	TARP Syndrome	BEFREE	21910224, 24000153, 27763814, 28577551, 28586478, 29274279, 30462380		★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
TARP syndrome	TARP Syndrome	ORPHANET_DG	21910224		★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
TARP syndrome	TARP Syndrome	Orphanet			★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
TARP syndrome	TARP Syndrome	CTD_human_DG			★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Tetralogy of Fallot	Tetralogy of Fallot	HPO_DG			★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	28634282	Associate	★☆☆☆☆ Found in Text Mining only
Uranostaphyloschisis	Uranostaphyloschisis	BEFREE	20451169		★☆☆☆☆ Found in Text Mining only
Vertical Talus	Vertical Talus	HPO_DG			★☆☆☆☆ Found in Text Mining only
Vision Disorders	Visual disorder	Pubtator	21910224	Associate	★☆☆☆☆ Found in Text Mining only

Related Genes

No strongly related genes found yet for RBM10.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to RBM10.