RBIS (ribosomal biogenesis factor)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 401466
Gene name Ribosomal biogenesis factor
Gene symbol RBIS
Synonyms (NCBI Gene)
C8orf59
Chromosome 8
Chromosome location 8q21.2
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
10 Show/Hide all (10)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 32296183
GO:0005634 Component Nucleus IEA
GO:0005654 Component Nucleoplasm IDA
GO:0005730 Component Nucleolus IBA
GO:0005730 Component Nucleolus IDA 26711351
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
HGNC N/A HGNC
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q8N0T1
Protein name Ribosomal biogenesis factor
Protein function Trans-acting factor in ribosome biogenesis required for efficient 40S and 60S subunit production.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF15679 DUF4665 1 → 100 Domain of unknown function (DUF4665) Family
Sequence 
MAKNKLRGPKSRNVFHIASQKNFKAKNKAKPVTTNLKKINIMNEEKVNRVNKAFVNVQKE
LAHFAKSISLEPLQKELIPQQRHESKPVNVDEATRLMALL
Sequence length 100
Interactions View interactions

No strongly related genes found yet for RBIS.

No additional diseases found yet through genes similar to RBIS.