RASSF7 (Ras association domain family member 7)

Download as csv Download as pdf

Log in to save this analysis

Save This Analysis

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Associated diseases Diseases linked via similar genes

Gene

• Entrez ID: 8045
• Gene name: Ras association domain family member 7
• Gene symbol: RASSF7
• Synonyms (NCBI Gene): C11orf13, CFAP88, FAP88, HRAS1, HRC1
• Chromosome: 11
• Chromosome location: 11p15.5

miRNA Show/Hide all (34)

miRTarBase ID	miRNA	Experiments	Reference
MIRT048225	hsa-miR-196a-5p	CLASH	23622248
MIRT1292995	hsa-miR-1273	CLIP-seq
MIRT1292996	hsa-miR-31	CLIP-seq
MIRT1292997	hsa-miR-3128	CLIP-seq
MIRT1292998	hsa-miR-3661	CLIP-seq
MIRT1292999	hsa-miR-4271	CLIP-seq
MIRT1293000	hsa-miR-4643	CLIP-seq
MIRT1293001	hsa-miR-4725-3p	CLIP-seq
MIRT1293002	hsa-miR-4759	CLIP-seq
MIRT1293003	hsa-miR-4795-5p	CLIP-seq
MIRT1293004	hsa-miR-631	CLIP-seq
MIRT2086986	hsa-miR-1538	CLIP-seq
MIRT2086987	hsa-miR-361-3p	CLIP-seq
MIRT2086988	hsa-miR-4286	CLIP-seq
MIRT2086989	hsa-miR-4436b-3p	CLIP-seq
MIRT2086990	hsa-miR-4745-3p	CLIP-seq
MIRT1293002	hsa-miR-4759	CLIP-seq
MIRT2086991	hsa-miR-4761-3p	CLIP-seq
MIRT2086992	hsa-miR-4779	CLIP-seq
MIRT1292999	hsa-miR-4271	CLIP-seq
MIRT1293000	hsa-miR-4643	CLIP-seq
MIRT1293001	hsa-miR-4725-3p	CLIP-seq
MIRT1293003	hsa-miR-4795-5p	CLIP-seq
MIRT2457810	hsa-miR-1260	CLIP-seq
MIRT2457811	hsa-miR-1260b	CLIP-seq
MIRT2457812	hsa-miR-188-3p	CLIP-seq
MIRT2457813	hsa-miR-1915	CLIP-seq
MIRT2457814	hsa-miR-3156-3p	CLIP-seq
MIRT2457815	hsa-miR-3158-3p	CLIP-seq
MIRT2457816	hsa-miR-4301	CLIP-seq
MIRT2457817	hsa-miR-4685-5p	CLIP-seq
MIRT2689362	hsa-miR-3151	CLIP-seq
MIRT2689363	hsa-miR-3689d	CLIP-seq
MIRT2689364	hsa-miR-486-3p	CLIP-seq

Gene ontology (GO) Show/Hide all (7)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	21988832, 24366813, 25416956, 31515488, 33961781
GO:0005737	Component	Cytoplasm	IEA
GO:0005813	Component	Centrosome	IEA
GO:0005856	Component	Cytoskeleton	IEA
GO:0006915	Process	Apoptotic process	IEA
GO:0007165	Process	Signal transduction	IEA
GO:0034451	Component	Centriolar satellite	IDA

Other IDs

• MIM: 143023
• HGNC: 1166
• e!Ensembl: ENSG00000099849

Protein

• UniProt ID: Q02833
• Protein name: Ras association domain-containing protein 7 (HRAS1-related cluster protein 1)
• Protein function: Negatively regulates stress-induced JNK activation and apoptosis by promoting MAP2K7 phosphorylation and inhibiting its ability to activate JNK. Following prolonged stress, anti-apoptotic effect stops because of degradation of RASSF7 protein via
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00788	RA	6 → 89	Ras association (RalGDS/AF-6) domain	Domain

• Sequence:

  MLLGLAAMELKVWVDGIQRVVCGVSEQTTCQEVVIALAQAIGQTGRFVLVQRLREKERQL
  LPQECPVGAQATCGQFASDVQFVLRRTGPSLAGRPSSDSCPPPERCLIRASLPVKPRAAL
  GCEPRKTLTPEPAPSLSRPGPAAPVTPTPGCCTDLRGLELRVQRNAEELGHEAFWEQELR
  REQAREREGQARLQALSAATAEHAARLQALDAQARALEAELQLAAEAPGPPSPMASATER
  LHQDLAVQERQSAEVQGSLALVSRALEAAERALQAQAQELEELNRELRQCNLQQFIQQTG
  AALPPPPRPDRGPPGTQGPLPPAREESLLGAPSESHAGAQPRPRGGPHDAELLEVAAAPA
  PEWCPLAAQPQAL

• Sequence length: 373

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Cervical cancer	Uncertain significance	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Uncertain significance	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining Show/Hide Text Mining Associations (50)
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adrenocortical carcinoma	Adrenocortical carcinoma	BEFREE	2564050		★☆☆☆☆ Found in Text Mining only
Aniridia	Aniridia	BEFREE	3037545		★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	BEFREE	8098541		★☆☆☆☆ Found in Text Mining only
Beckwith-Wiedemann Syndrome	Beckwith-Wiedemann Syndrome	BEFREE	2905880		★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar Disorder	BEFREE	1973904, 2881210		★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	12115522		★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	BEFREE	11753967		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	10464642, 10601382, 14693748, 21221763, 7547224, 8416194, 8589723, 8987214, 9949211		★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	30139745	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	12115522, 3474107		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	10430091, 10697610, 11097227, 1910603, 29108261		★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	10667571		★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	11724366		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	11724366, 12433710, 8336750		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	1978827, 26884887		★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	10667571		★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary Breast And Ovarian Cancer Syndrome	BEFREE	8589723		★☆☆☆☆ Found in Text Mining only
Hereditary Melanoma	Hereditary cutaneous melanoma	BEFREE	2573274		★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral Disc Degeneration	BEFREE	26884887		★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral disc disease	Pubtator	26884887	Associate	★☆☆☆☆ Found in Text Mining only
Intervertebral disc disorder	Intervertebral Disc Disorder	BEFREE	26884887		★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	2713271		★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	2713271		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	29729697		★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	16410370		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	16410370		★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	24516056	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	8104094		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	10464642, 10601382, 14693748, 21221763, 7547224, 8589723, 8987214, 9949211		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	10430091, 10697610, 11097227, 1910603, 29108261		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	10667571		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	2565762		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	24573726		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	12115522		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	10601382, 11097227, 12115522, 12470840, 24573726, 29729697, 30139745, 7987639, 8336750, 8589723, 9949211		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	2894003		★☆☆☆☆ Found in Text Mining only
Mood Disorders	Mood Disorder	BEFREE	3547139		★☆☆☆☆ Found in Text Mining only
Multiple Endocrine Neoplasia Type 1	Multiple Endocrine Neoplasia	BEFREE	2565762		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10697610, 11097227, 11724366, 11753967, 15277242, 16908535, 20485437, 22695170, 2550179, 2565762, 26569555, 8402459, 9294609		★☆☆☆☆ Found in Text Mining only
Nephroblastoma	Nephroblastoma	BEFREE	3037545		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	16822308, 22695170		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	22695170	Associate	★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	29108261, 7664270		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	10667571		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	9294609		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	24573726		★☆☆☆☆ Found in Text Mining only
Thyroid cancer medullary	Medullary thyroid cancer	Pubtator	24516056	Stimulate	★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	24516056	Stimulate	★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	LHGDN	15098441		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	24516056	Associate	★☆☆☆☆ Found in Text Mining only

Related Genes

No strongly related genes found yet for RASSF7.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to RASSF7.