Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs Transcription factors Other IDs Associated diseases
Entrez ID	5914
Gene name	Retinoic acid receptor alpha
Gene symbol	RARA
Synonyms (NCBI Gene)	NR1B1RARRARalpha
Chromosome	17
Chromosome location	17q21.2
Summary	This gene represents a nuclear retinoic acid receptor. The encoded protein, retinoic acid receptor alpha, regulates transcription in a ligand-dependent manner. This gene has been implicated in regulation of development, differentiation, apoptosis, granulo

Show/Hide all (2)

SNP ID	Visualize variation	Clinical significance	Consequence
rs786205678	C>T	Drug-response	Missense variant, coding sequence variant
rs1555574254	TCATCCAGGAAATGTTGGAGAACTCAGAGGGCCTGGACACTCTGAGCGGACAGCCGGGGGGTGGGGGGCGGGACGGGGGTGGCCTGGCCCCCCCGCCAGGCAGCTGTAGCCCCAGCCTCAGCCCCAGCTCCAACAGAAGCAGCCCGGCCACCCACTCCCCGTGAC>-	Drug-response	Terminator codon variant, 3 prime UTR variant, stop lost, inframe indel

413

Show/Hide all (413)

miRTarBase ID	miRNA	Experiments	Reference
MIRT004389	hsa-miR-125a-5p	MicroarrayNorthern blot	16331254
MIRT024237	hsa-miR-218-5p	Sequencing	20371350
MIRT045829	hsa-miR-138-5p	CLASH	23622248
MIRT039873	hsa-miR-615-3p	CLASH	23622248
MIRT469581	hsa-miR-3714	PAR-CLIP	23592263
MIRT469582	hsa-miR-6808-5p	PAR-CLIP	23592263
MIRT469580	hsa-miR-6893-5p	PAR-CLIP	23592263
MIRT469579	hsa-miR-940	PAR-CLIP	23592263
MIRT469578	hsa-miR-1321	PAR-CLIP	23592263
MIRT469577	hsa-miR-4739	PAR-CLIP	23592263
MIRT469576	hsa-miR-4756-5p	PAR-CLIP	23592263
MIRT469575	hsa-miR-6783-5p	PAR-CLIP	23592263
MIRT469574	hsa-miR-194-3p	PAR-CLIP	23592263
MIRT469573	hsa-miR-766-3p	PAR-CLIP	23592263
MIRT469572	hsa-miR-3925-3p	PAR-CLIP	23592263
MIRT469571	hsa-miR-605-3p	PAR-CLIP	23592263
MIRT469570	hsa-miR-4419a	PAR-CLIP	23592263
MIRT469569	hsa-miR-4510	PAR-CLIP	23592263
MIRT469568	hsa-miR-6127	PAR-CLIP	23592263
MIRT469567	hsa-miR-6129	PAR-CLIP	23592263
MIRT469566	hsa-miR-6130	PAR-CLIP	23592263
MIRT469565	hsa-miR-6133	PAR-CLIP	23592263
MIRT469564	hsa-miR-1249-5p	PAR-CLIP	23592263
MIRT469563	hsa-miR-6797-5p	PAR-CLIP	23592263
MIRT469562	hsa-miR-4747-5p	PAR-CLIP	23592263
MIRT469560	hsa-miR-5196-5p	PAR-CLIP	23592263
MIRT469561	hsa-miR-7106-5p	PAR-CLIP	23592263
MIRT469559	hsa-miR-6799-5p	PAR-CLIP	23592263
MIRT469558	hsa-miR-4271	PAR-CLIP	23592263
MIRT469557	hsa-miR-4725-3p	PAR-CLIP	23592263
MIRT469556	hsa-miR-6780b-5p	PAR-CLIP	23592263
MIRT469555	hsa-miR-1233-5p	PAR-CLIP	23592263
MIRT469554	hsa-miR-6778-5p	PAR-CLIP	23592263
MIRT469553	hsa-miR-515-5p	PAR-CLIP	23592263
MIRT469552	hsa-miR-519e-5p	PAR-CLIP	23592263
MIRT469551	hsa-miR-1273h-5p	PAR-CLIP	23592263
MIRT469550	hsa-miR-30b-3p	PAR-CLIP	23592263
MIRT469549	hsa-miR-3689a-3p	PAR-CLIP	23592263
MIRT469548	hsa-miR-3689b-3p	PAR-CLIP	23592263
MIRT469547	hsa-miR-3689c	PAR-CLIP	23592263
MIRT469546	hsa-miR-6779-5p	PAR-CLIP	23592263
MIRT469545	hsa-miR-6780a-5p	PAR-CLIP	23592263
MIRT045829	hsa-miR-138-5p	Luciferase reporter assayWestern blot	25680531
MIRT045829	hsa-miR-138-5p	Luciferase reporter assayWestern blot	25680531
MIRT734634	hsa-miR-146b-3p	qRT-PCR	34009317
MIRT045829	hsa-miR-138-5p	Luciferase reporter assayWestern blottingqRT-PCR	33935126
MIRT469581	hsa-miR-3714	PAR-CLIP	23592263
MIRT469582	hsa-miR-6808-5p	PAR-CLIP	23592263
MIRT469580	hsa-miR-6893-5p	PAR-CLIP	23592263
MIRT469579	hsa-miR-940	PAR-CLIP	23592263
MIRT469578	hsa-miR-1321	PAR-CLIP	23592263
MIRT469577	hsa-miR-4739	PAR-CLIP	23592263
MIRT469576	hsa-miR-4756-5p	PAR-CLIP	23592263
MIRT469575	hsa-miR-6783-5p	PAR-CLIP	23592263
MIRT469574	hsa-miR-194-3p	PAR-CLIP	23592263
MIRT469573	hsa-miR-766-3p	PAR-CLIP	23592263
MIRT469572	hsa-miR-3925-3p	PAR-CLIP	23592263
MIRT469571	hsa-miR-605-3p	PAR-CLIP	23592263
MIRT469570	hsa-miR-4419a	PAR-CLIP	23592263
MIRT469569	hsa-miR-4510	PAR-CLIP	23592263
MIRT469568	hsa-miR-6127	PAR-CLIP	23592263
MIRT469567	hsa-miR-6129	PAR-CLIP	23592263
MIRT469566	hsa-miR-6130	PAR-CLIP	23592263
MIRT469565	hsa-miR-6133	PAR-CLIP	23592263
MIRT469564	hsa-miR-1249-5p	PAR-CLIP	23592263
MIRT469563	hsa-miR-6797-5p	PAR-CLIP	23592263
MIRT469562	hsa-miR-4747-5p	PAR-CLIP	23592263
MIRT469560	hsa-miR-5196-5p	PAR-CLIP	23592263
MIRT469561	hsa-miR-7106-5p	PAR-CLIP	23592263
MIRT469559	hsa-miR-6799-5p	PAR-CLIP	23592263
MIRT469558	hsa-miR-4271	PAR-CLIP	23592263
MIRT469557	hsa-miR-4725-3p	PAR-CLIP	23592263
MIRT469556	hsa-miR-6780b-5p	PAR-CLIP	23592263
MIRT469555	hsa-miR-1233-5p	PAR-CLIP	23592263
MIRT469554	hsa-miR-6778-5p	PAR-CLIP	23592263
MIRT469553	hsa-miR-515-5p	PAR-CLIP	23592263
MIRT469552	hsa-miR-519e-5p	PAR-CLIP	23592263
MIRT469551	hsa-miR-1273h-5p	PAR-CLIP	23592263
MIRT469550	hsa-miR-30b-3p	PAR-CLIP	23592263
MIRT469549	hsa-miR-3689a-3p	PAR-CLIP	23592263
MIRT469548	hsa-miR-3689b-3p	PAR-CLIP	23592263
MIRT469547	hsa-miR-3689c	PAR-CLIP	23592263
MIRT469546	hsa-miR-6779-5p	PAR-CLIP	23592263
MIRT469545	hsa-miR-6780a-5p	PAR-CLIP	23592263
MIRT1291428	hsa-miR-1207-3p	CLIP-seq
MIRT1291429	hsa-miR-1207-5p	CLIP-seq
MIRT1291430	hsa-miR-1245b-5p	CLIP-seq
MIRT1291431	hsa-miR-1247	CLIP-seq
MIRT1291432	hsa-miR-1252	CLIP-seq
MIRT1291433	hsa-miR-1275	CLIP-seq
MIRT1291434	hsa-miR-1278	CLIP-seq
MIRT1291435	hsa-miR-128	CLIP-seq
MIRT1291436	hsa-miR-1282	CLIP-seq
MIRT1291437	hsa-miR-1291	CLIP-seq
MIRT1291438	hsa-miR-1302	CLIP-seq
MIRT1291439	hsa-miR-138	CLIP-seq
MIRT1291440	hsa-miR-147	CLIP-seq
MIRT1291441	hsa-miR-151-5p	CLIP-seq
MIRT1291442	hsa-miR-151b	CLIP-seq
MIRT1291443	hsa-miR-1539	CLIP-seq
MIRT1291444	hsa-miR-1825	CLIP-seq
MIRT1291445	hsa-miR-1827	CLIP-seq
MIRT1291446	hsa-miR-183	CLIP-seq
MIRT1291447	hsa-miR-1909	CLIP-seq
MIRT1291448	hsa-miR-198	CLIP-seq
MIRT1291449	hsa-miR-199a-5p	CLIP-seq
MIRT1291450	hsa-miR-199b-5p	CLIP-seq
MIRT1291451	hsa-miR-205	CLIP-seq
MIRT1291452	hsa-miR-218	CLIP-seq
MIRT1291453	hsa-miR-27a	CLIP-seq
MIRT1291454	hsa-miR-27b	CLIP-seq
MIRT1291455	hsa-miR-296-5p	CLIP-seq
MIRT1291456	hsa-miR-299-3p	CLIP-seq
MIRT1291457	hsa-miR-3127-3p	CLIP-seq
MIRT1291458	hsa-miR-3142	CLIP-seq
MIRT1291459	hsa-miR-3150a-3p	CLIP-seq
MIRT1291460	hsa-miR-3160-3p	CLIP-seq
MIRT1291461	hsa-miR-3170	CLIP-seq
MIRT1291462	hsa-miR-3173-3p	CLIP-seq
MIRT1291463	hsa-miR-3175	CLIP-seq
MIRT1291464	hsa-miR-3179	CLIP-seq
MIRT1291465	hsa-miR-3181	CLIP-seq
MIRT1291466	hsa-miR-3184	CLIP-seq
MIRT1291467	hsa-miR-3193	CLIP-seq
MIRT1291468	hsa-miR-3194-3p	CLIP-seq
MIRT1291469	hsa-miR-3194-5p	CLIP-seq
MIRT1291470	hsa-miR-3202	CLIP-seq
MIRT1291471	hsa-miR-323b-3p	CLIP-seq
MIRT1291472	hsa-miR-331-3p	CLIP-seq
MIRT1291473	hsa-miR-342-5p	CLIP-seq
MIRT1291474	hsa-miR-3612	CLIP-seq
MIRT1291475	hsa-miR-361-3p	CLIP-seq
MIRT1291476	hsa-miR-3616-3p	CLIP-seq
MIRT1291477	hsa-miR-3646	CLIP-seq
MIRT1291478	hsa-miR-3662	CLIP-seq
MIRT1291479	hsa-miR-3675-5p	CLIP-seq
MIRT1291480	hsa-miR-374c	CLIP-seq
MIRT1291481	hsa-miR-3919	CLIP-seq
MIRT1291482	hsa-miR-3939	CLIP-seq
MIRT1291483	hsa-miR-3978	CLIP-seq
MIRT1291484	hsa-miR-423-5p	CLIP-seq
MIRT1291485	hsa-miR-4265	CLIP-seq
MIRT1291486	hsa-miR-4267	CLIP-seq
MIRT1291487	hsa-miR-4296	CLIP-seq
MIRT1291488	hsa-miR-4298	CLIP-seq
MIRT1291489	hsa-miR-4299	CLIP-seq
MIRT1291490	hsa-miR-4302	CLIP-seq
MIRT1291491	hsa-miR-4322	CLIP-seq
MIRT1291492	hsa-miR-4417	CLIP-seq
MIRT1291493	hsa-miR-4428	CLIP-seq
MIRT1291494	hsa-miR-4435	CLIP-seq
MIRT1291495	hsa-miR-4447	CLIP-seq
MIRT1291496	hsa-miR-4456	CLIP-seq
MIRT1291497	hsa-miR-4467	CLIP-seq
MIRT1291498	hsa-miR-4472	CLIP-seq
MIRT1291499	hsa-miR-4487	CLIP-seq
MIRT1291500	hsa-miR-4488	CLIP-seq
MIRT1291501	hsa-miR-4492	CLIP-seq
MIRT1291502	hsa-miR-4498	CLIP-seq
MIRT1291503	hsa-miR-4505	CLIP-seq
MIRT1291504	hsa-miR-4508	CLIP-seq
MIRT1291505	hsa-miR-4648	CLIP-seq
MIRT1291506	hsa-miR-4649-3p	CLIP-seq
MIRT1291507	hsa-miR-4650-3p	CLIP-seq
MIRT1291508	hsa-miR-4650-5p	CLIP-seq
MIRT1291509	hsa-miR-4651	CLIP-seq
MIRT1291510	hsa-miR-4660	CLIP-seq
MIRT1291511	hsa-miR-4664-5p	CLIP-seq
MIRT1291512	hsa-miR-4665-5p	CLIP-seq
MIRT1291513	hsa-miR-4667-5p	CLIP-seq
MIRT1291514	hsa-miR-4672	CLIP-seq
MIRT1291515	hsa-miR-4697-5p	CLIP-seq
MIRT1291516	hsa-miR-4699-5p	CLIP-seq
MIRT1291517	hsa-miR-4700-5p	CLIP-seq
MIRT1291518	hsa-miR-4706	CLIP-seq
MIRT1291519	hsa-miR-4710	CLIP-seq
MIRT1291520	hsa-miR-4716-5p	CLIP-seq
MIRT1291521	hsa-miR-4717-3p	CLIP-seq
MIRT1291522	hsa-miR-4719	CLIP-seq
MIRT1291523	hsa-miR-4720-3p	CLIP-seq
MIRT1291524	hsa-miR-4721	CLIP-seq
MIRT1291525	hsa-miR-4728-5p	CLIP-seq
MIRT1291526	hsa-miR-4731-5p	CLIP-seq
MIRT1291527	hsa-miR-4732-3p	CLIP-seq
MIRT1291528	hsa-miR-4734	CLIP-seq
MIRT1291529	hsa-miR-4736	CLIP-seq
MIRT1291530	hsa-miR-4747-3p	CLIP-seq
MIRT1291531	hsa-miR-4749-5p	CLIP-seq
MIRT1291532	hsa-miR-4757-5p	CLIP-seq
MIRT1291533	hsa-miR-4763-3p	CLIP-seq
MIRT1291534	hsa-miR-4782-5p	CLIP-seq
MIRT1291535	hsa-miR-4787-5p	CLIP-seq
MIRT1291536	hsa-miR-4792	CLIP-seq
MIRT1291537	hsa-miR-4804-3p	CLIP-seq
MIRT1291538	hsa-miR-486-3p	CLIP-seq
MIRT1291539	hsa-miR-513a-5p	CLIP-seq
MIRT1291540	hsa-miR-548aa	CLIP-seq
MIRT1291541	hsa-miR-548an	CLIP-seq
MIRT1291542	hsa-miR-555	CLIP-seq
MIRT1291543	hsa-miR-558	CLIP-seq
MIRT1291544	hsa-miR-576-3p	CLIP-seq
MIRT1291545	hsa-miR-599	CLIP-seq
MIRT1291546	hsa-miR-608	CLIP-seq
MIRT1291547	hsa-miR-619	CLIP-seq
MIRT1291548	hsa-miR-636	CLIP-seq
MIRT1291549	hsa-miR-637	CLIP-seq
MIRT1291550	hsa-miR-650	CLIP-seq
MIRT1291551	hsa-miR-655	CLIP-seq
MIRT1291552	hsa-miR-711	CLIP-seq
MIRT1291553	hsa-miR-744	CLIP-seq
MIRT1291554	hsa-miR-762	CLIP-seq
MIRT1291555	hsa-miR-766	CLIP-seq
MIRT1291556	hsa-miR-933	CLIP-seq
MIRT1291557	hsa-miR-939	CLIP-seq
MIRT1291431	hsa-miR-1247	CLIP-seq
MIRT1291558	hsa-miR-1276	CLIP-seq
MIRT1291434	hsa-miR-1278	CLIP-seq
MIRT1291435	hsa-miR-128	CLIP-seq
MIRT1291559	hsa-miR-1470	CLIP-seq
MIRT1291560	hsa-miR-1913	CLIP-seq
MIRT1291561	hsa-miR-1915	CLIP-seq
MIRT1291562	hsa-miR-194	CLIP-seq
MIRT1291451	hsa-miR-205	CLIP-seq
MIRT1291452	hsa-miR-218	CLIP-seq
MIRT1291563	hsa-miR-2355-5p	CLIP-seq
MIRT1291453	hsa-miR-27a	CLIP-seq
MIRT1291454	hsa-miR-27b	CLIP-seq
MIRT1291564	hsa-miR-3150b-3p	CLIP-seq
MIRT1291565	hsa-miR-3153	CLIP-seq
MIRT1291566	hsa-miR-3189-5p	CLIP-seq
MIRT1291567	hsa-miR-3192	CLIP-seq
MIRT1291471	hsa-miR-323b-3p	CLIP-seq
MIRT1291568	hsa-miR-324-3p	CLIP-seq
MIRT1291475	hsa-miR-361-3p	CLIP-seq
MIRT1291477	hsa-miR-3646	CLIP-seq
MIRT1291569	hsa-miR-3647-3p	CLIP-seq
MIRT1291478	hsa-miR-3662	CLIP-seq
MIRT1291570	hsa-miR-3664-5p	CLIP-seq
MIRT1291571	hsa-miR-3929	CLIP-seq
MIRT1291483	hsa-miR-3978	CLIP-seq
MIRT1291572	hsa-miR-4264	CLIP-seq
MIRT1291573	hsa-miR-4311	CLIP-seq
MIRT1291574	hsa-miR-4314	CLIP-seq
MIRT1291575	hsa-miR-4328	CLIP-seq
MIRT1291576	hsa-miR-4419b	CLIP-seq
MIRT1291577	hsa-miR-4446-3p	CLIP-seq
MIRT1291578	hsa-miR-4449	CLIP-seq
MIRT1291579	hsa-miR-4469	CLIP-seq
MIRT1291580	hsa-miR-4478	CLIP-seq
MIRT1291581	hsa-miR-4532	CLIP-seq
MIRT1291582	hsa-miR-4646-5p	CLIP-seq
MIRT1291583	hsa-miR-4667-3p	CLIP-seq
MIRT1291584	hsa-miR-4668-5p	CLIP-seq
MIRT1291514	hsa-miR-4672	CLIP-seq
MIRT1291585	hsa-miR-4689	CLIP-seq
MIRT1291586	hsa-miR-4695-3p	CLIP-seq
MIRT1291587	hsa-miR-4709-5p	CLIP-seq
MIRT1291588	hsa-miR-4712-5p	CLIP-seq
MIRT1291522	hsa-miR-4719	CLIP-seq
MIRT1291523	hsa-miR-4720-3p	CLIP-seq
MIRT1291589	hsa-miR-4758-3p	CLIP-seq
MIRT1291590	hsa-miR-4784	CLIP-seq
MIRT1291591	hsa-miR-4797-3p	CLIP-seq
MIRT1291537	hsa-miR-4804-3p	CLIP-seq
MIRT1291592	hsa-miR-493	CLIP-seq
MIRT1291539	hsa-miR-513a-5p	CLIP-seq
MIRT1291593	hsa-miR-548a-3p	CLIP-seq
MIRT1291594	hsa-miR-548e	CLIP-seq
MIRT1291595	hsa-miR-548f	CLIP-seq
MIRT1291596	hsa-miR-552	CLIP-seq
MIRT1291597	hsa-miR-583	CLIP-seq
MIRT1291548	hsa-miR-636	CLIP-seq
MIRT1291598	hsa-miR-639	CLIP-seq
MIRT1291599	hsa-miR-764	CLIP-seq
MIRT1291600	hsa-miR-770-5p	CLIP-seq
MIRT1291601	hsa-miR-802	CLIP-seq
MIRT1291428	hsa-miR-1207-3p	CLIP-seq
MIRT1291429	hsa-miR-1207-5p	CLIP-seq
MIRT2086752	hsa-miR-1231	CLIP-seq
MIRT1291431	hsa-miR-1247	CLIP-seq
MIRT1291439	hsa-miR-138	CLIP-seq
MIRT1291440	hsa-miR-147	CLIP-seq
MIRT1291559	hsa-miR-1470	CLIP-seq
MIRT1291444	hsa-miR-1825	CLIP-seq
MIRT1291445	hsa-miR-1827	CLIP-seq
MIRT1291447	hsa-miR-1909	CLIP-seq
MIRT1291560	hsa-miR-1913	CLIP-seq
MIRT1291562	hsa-miR-194	CLIP-seq
MIRT1291449	hsa-miR-199a-5p	CLIP-seq
MIRT1291450	hsa-miR-199b-5p	CLIP-seq
MIRT1291563	hsa-miR-2355-5p	CLIP-seq
MIRT1291459	hsa-miR-3150a-3p	CLIP-seq
MIRT1291463	hsa-miR-3175	CLIP-seq
MIRT1291566	hsa-miR-3189-5p	CLIP-seq
MIRT1291568	hsa-miR-324-3p	CLIP-seq
MIRT1291475	hsa-miR-361-3p	CLIP-seq
MIRT1291479	hsa-miR-3675-5p	CLIP-seq
MIRT2086753	hsa-miR-3911	CLIP-seq
MIRT1291481	hsa-miR-3919	CLIP-seq
MIRT1291482	hsa-miR-3939	CLIP-seq
MIRT1291483	hsa-miR-3978	CLIP-seq
MIRT1291572	hsa-miR-4264	CLIP-seq
MIRT1291489	hsa-miR-4299	CLIP-seq
MIRT1291577	hsa-miR-4446-3p	CLIP-seq
MIRT1291579	hsa-miR-4469	CLIP-seq
MIRT2086754	hsa-miR-4480	CLIP-seq
MIRT1291500	hsa-miR-4488	CLIP-seq
MIRT1291507	hsa-miR-4650-3p	CLIP-seq
MIRT1291508	hsa-miR-4650-5p	CLIP-seq
MIRT1291583	hsa-miR-4667-3p	CLIP-seq
MIRT1291513	hsa-miR-4667-5p	CLIP-seq
MIRT1291586	hsa-miR-4695-3p	CLIP-seq
MIRT1291515	hsa-miR-4697-5p	CLIP-seq
MIRT1291517	hsa-miR-4700-5p	CLIP-seq
MIRT1291518	hsa-miR-4706	CLIP-seq
MIRT1291587	hsa-miR-4709-5p	CLIP-seq
MIRT1291588	hsa-miR-4712-5p	CLIP-seq
MIRT2086755	hsa-miR-4723-5p	CLIP-seq
MIRT1291526	hsa-miR-4731-5p	CLIP-seq
MIRT1291531	hsa-miR-4749-5p	CLIP-seq
MIRT1291532	hsa-miR-4757-5p	CLIP-seq
MIRT1291589	hsa-miR-4758-3p	CLIP-seq
MIRT1291533	hsa-miR-4763-3p	CLIP-seq
MIRT1291591	hsa-miR-4797-3p	CLIP-seq
MIRT1291541	hsa-miR-548an	CLIP-seq
MIRT1291596	hsa-miR-552	CLIP-seq
MIRT1291545	hsa-miR-599	CLIP-seq
MIRT1291549	hsa-miR-637	CLIP-seq
MIRT2086756	hsa-miR-644	CLIP-seq
MIRT1291553	hsa-miR-744	CLIP-seq
MIRT1291599	hsa-miR-764	CLIP-seq
MIRT1291600	hsa-miR-770-5p	CLIP-seq
MIRT1291601	hsa-miR-802	CLIP-seq
MIRT1291556	hsa-miR-933	CLIP-seq
MIRT2086757	hsa-miR-936	CLIP-seq
MIRT1291557	hsa-miR-939	CLIP-seq
MIRT1291428	hsa-miR-1207-3p	CLIP-seq
MIRT1291433	hsa-miR-1275	CLIP-seq
MIRT1291439	hsa-miR-138	CLIP-seq
MIRT1291560	hsa-miR-1913	CLIP-seq
MIRT1291562	hsa-miR-194	CLIP-seq
MIRT1291451	hsa-miR-205	CLIP-seq
MIRT1291452	hsa-miR-218	CLIP-seq
MIRT2311681	hsa-miR-3130-5p	CLIP-seq
MIRT1291462	hsa-miR-3173-3p	CLIP-seq
MIRT1291465	hsa-miR-3181	CLIP-seq
MIRT1291566	hsa-miR-3189-5p	CLIP-seq
MIRT1291471	hsa-miR-323b-3p	CLIP-seq
MIRT1291568	hsa-miR-324-3p	CLIP-seq
MIRT1291472	hsa-miR-331-3p	CLIP-seq
MIRT1291473	hsa-miR-342-5p	CLIP-seq
MIRT1291475	hsa-miR-361-3p	CLIP-seq
MIRT1291476	hsa-miR-3616-3p	CLIP-seq
MIRT1291477	hsa-miR-3646	CLIP-seq
MIRT1291478	hsa-miR-3662	CLIP-seq
MIRT2311682	hsa-miR-3928	CLIP-seq
MIRT1291483	hsa-miR-3978	CLIP-seq
MIRT1291572	hsa-miR-4264	CLIP-seq
MIRT1291486	hsa-miR-4267	CLIP-seq
MIRT1291489	hsa-miR-4299	CLIP-seq
MIRT1291577	hsa-miR-4446-3p	CLIP-seq
MIRT2086754	hsa-miR-4480	CLIP-seq
MIRT2311683	hsa-miR-4482	CLIP-seq
MIRT1291511	hsa-miR-4664-5p	CLIP-seq
MIRT1291512	hsa-miR-4665-5p	CLIP-seq
MIRT1291514	hsa-miR-4672	CLIP-seq
MIRT2311684	hsa-miR-4694-3p	CLIP-seq
MIRT1291586	hsa-miR-4695-3p	CLIP-seq
MIRT1291518	hsa-miR-4706	CLIP-seq
MIRT1291587	hsa-miR-4709-5p	CLIP-seq
MIRT1291588	hsa-miR-4712-5p	CLIP-seq
MIRT1291522	hsa-miR-4719	CLIP-seq
MIRT1291523	hsa-miR-4720-3p	CLIP-seq
MIRT1291524	hsa-miR-4721	CLIP-seq
MIRT1291526	hsa-miR-4731-5p	CLIP-seq
MIRT1291531	hsa-miR-4749-5p	CLIP-seq
MIRT1291589	hsa-miR-4758-3p	CLIP-seq
MIRT1291591	hsa-miR-4797-3p	CLIP-seq
MIRT2311685	hsa-miR-4802-5p	CLIP-seq
MIRT1291537	hsa-miR-4804-3p	CLIP-seq
MIRT1291538	hsa-miR-486-3p	CLIP-seq
MIRT1291539	hsa-miR-513a-5p	CLIP-seq
MIRT1291596	hsa-miR-552	CLIP-seq
MIRT2311686	hsa-miR-595	CLIP-seq
MIRT1291548	hsa-miR-636	CLIP-seq
MIRT1291549	hsa-miR-637	CLIP-seq
MIRT1291553	hsa-miR-744	CLIP-seq
MIRT1291599	hsa-miR-764	CLIP-seq
MIRT2311687	hsa-miR-765	CLIP-seq
MIRT1291600	hsa-miR-770-5p	CLIP-seq
MIRT1291601	hsa-miR-802	CLIP-seq
MIRT2086757	hsa-miR-936	CLIP-seq
MIRT1291431	hsa-miR-1247	CLIP-seq
MIRT1291559	hsa-miR-1470	CLIP-seq
MIRT1291561	hsa-miR-1915	CLIP-seq
MIRT1291475	hsa-miR-361-3p	CLIP-seq
MIRT1291486	hsa-miR-4267	CLIP-seq
MIRT1291579	hsa-miR-4469	CLIP-seq
MIRT2608018	hsa-miR-4640-3p	CLIP-seq
MIRT1291583	hsa-miR-4667-3p	CLIP-seq
MIRT1291534	hsa-miR-4782-5p	CLIP-seq
MIRT1291555	hsa-miR-766	CLIP-seq
MIRT1291557	hsa-miR-939	CLIP-seq
MIRT1291431	hsa-miR-1247	CLIP-seq
MIRT1291559	hsa-miR-1470	CLIP-seq
MIRT1291561	hsa-miR-1915	CLIP-seq
MIRT1291475	hsa-miR-361-3p	CLIP-seq
MIRT1291486	hsa-miR-4267	CLIP-seq
MIRT1291579	hsa-miR-4469	CLIP-seq
MIRT2608018	hsa-miR-4640-3p	CLIP-seq
MIRT1291583	hsa-miR-4667-3p	CLIP-seq
MIRT1291534	hsa-miR-4782-5p	CLIP-seq
MIRT1291555	hsa-miR-766	CLIP-seq

Show/Hide all (6)

Transcription factor	Regulation	Reference
CRABP2	Activation	16166294
CREBBP	Unknown	21110951
ESR1	Activation	9626663
JUN	Repression	9377582
KLF4	Repression	19531492
SP1	Activation	9626663

138

Show/Hide all (138)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IBA
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0000785	Component	Chromatin	IDA	2825025
GO:0000785	Component	Chromatin	IDA	17363140, 21131358
GO:0000785	Component	Chromatin	ISA
GO:0000900	Function	MRNA regulatory element binding translation repressor activity	IEA
GO:0000976	Function	Transcription cis-regulatory region binding	IEA
GO:0000977	Function	RNA polymerase II transcription regulatory region sequence-specific DNA binding	IDA	19917671
GO:0000977	Function	RNA polymerase II transcription regulatory region sequence-specific DNA binding	IEA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IDA	20080953, 21131358
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IMP	28122350
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0001217	Function	DNA-binding transcription repressor activity	IMP	28122350
GO:0001223	Function	Transcription coactivator binding	IEA
GO:0001223	Function	Transcription coactivator binding	IPI	17641689
GO:0001657	Process	Ureteric bud development	IEA
GO:0001843	Process	Neural tube closure	IEA
GO:0001889	Process	Liver development	IEA
GO:0001972	Function	Retinoic acid binding	IDA	2825025
GO:0002068	Process	Glandular epithelial cell development	IEA
GO:0003148	Process	Outflow tract septum morphogenesis	IEA
GO:0003417	Process	Growth plate cartilage development	IEA
GO:0003677	Function	DNA binding	IEA
GO:0003682	Function	Chromatin binding	IDA	20080953
GO:0003700	Function	DNA-binding transcription factor activity	IDA	18922886, 20413580
GO:0003700	Function	DNA-binding transcription factor activity	IEA
GO:0004879	Function	Nuclear receptor activity	IBA
GO:0004879	Function	Nuclear receptor activity	IDA	2825025, 21131358
GO:0004879	Function	Nuclear receptor activity	IEA
GO:0005102	Function	Signaling receptor binding	IDA	19628791
GO:0005515	Function	Protein binding	IPI	9653119, 16189514, 16456540, 16606617, 16769902, 17363140, 17560333, 17641689, 18048326, 19345331, 19850744, 19917671, 19934264, 20080953, 20133701, 20211142, 20543827, 21478865, 21516116, 21988832, 22056876, 22351778, 23518351, 23693014, 24819975, 25036637, 25241761, 25303530, 2541
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	18845237, 19917671, 20080953
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	IEA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005667	Component	Transcription regulator complex	IEA
GO:0005667	Component	Transcription regulator complex	IPI	9430642, 10698945, 20543827, 21152046
GO:0005730	Component	Nucleolus	IDA
GO:0005737	Component	Cytoplasm	IDA	19850744
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA
GO:0005886	Component	Plasma membrane	IDA	2825025
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006468	Process	Protein phosphorylation	IMP	16456540
GO:0007281	Process	Germ cell development	IEA
GO:0007283	Process	Spermatogenesis	IEA
GO:0007565	Process	Female pregnancy	IEA
GO:0008270	Function	Zinc ion binding	IEA
GO:0008284	Process	Positive regulation of cell population proliferation	IEA
GO:0008284	Process	Positive regulation of cell population proliferation	IMP	20080953
GO:0008285	Process	Negative regulation of cell population proliferation	IEA
GO:0008584	Process	Male gonad development	IEA
GO:0010628	Process	Positive regulation of gene expression	IEA
GO:0010629	Process	Negative regulation of gene expression	IEA
GO:0015629	Component	Actin cytoskeleton	IDA
GO:0017148	Process	Negative regulation of translation	IEA
GO:0019899	Function	Enzyme binding	IPI	9628876, 12039952
GO:0019904	Function	Protein domain specific binding	IPI	20413580
GO:0021766	Process	Hippocampus development	IEA
GO:0030154	Process	Cell differentiation	IBA
GO:0030425	Component	Dendrite	IEA
GO:0030850	Process	Prostate gland development	IEA
GO:0030852	Process	Regulation of granulocyte differentiation	IEA
GO:0030853	Process	Negative regulation of granulocyte differentiation	IDA	19917671
GO:0031076	Process	Embryonic camera-type eye development	IEA
GO:0031490	Function	Chromatin DNA binding	IDA	19917671
GO:0031641	Process	Regulation of myelination	IEA
GO:0032355	Process	Response to estradiol	IEA
GO:0032526	Process	Response to retinoic acid	IEA
GO:0032526	Process	Response to retinoic acid	IMP	17538076
GO:0032689	Process	Negative regulation of type II interferon production	IDA	18416830
GO:0032720	Process	Negative regulation of tumor necrosis factor production	IDA	18416830
GO:0032736	Process	Positive regulation of interleukin-13 production	IDA	18416830
GO:0032753	Process	Positive regulation of interleukin-4 production	IDA	18416830
GO:0032754	Process	Positive regulation of interleukin-5 production	IDA	18416830
GO:0032991	Component	Protein-containing complex	IDA	19917671, 20080953
GO:0033189	Process	Response to vitamin A	IEA
GO:0034097	Process	Response to cytokine	IEA
GO:0035264	Process	Multicellular organism growth	IEA
GO:0042789	Process	MRNA transcription by RNA polymerase II	IDA	1310351
GO:0042789	Process	MRNA transcription by RNA polymerase II	NAS	9430642
GO:0042826	Function	Histone deacetylase binding	IEA
GO:0042981	Process	Regulation of apoptotic process	IEA
GO:0043066	Process	Negative regulation of apoptotic process	IEA
GO:0043277	Process	Apoptotic cell clearance	IMP	19628791
GO:0043422	Function	Protein kinase B binding	IPI	16417524
GO:0043565	Function	Sequence-specific DNA binding	IEA
GO:0044323	Function	Retinoic acid-responsive element binding	IDA	19917671
GO:0045471	Process	Response to ethanol	IEA
GO:0045596	Process	Negative regulation of cell differentiation	IEA
GO:0045630	Process	Positive regulation of T-helper 2 cell differentiation	IDA	18416830
GO:0045666	Process	Positive regulation of neuron differentiation	IEA
GO:0045787	Process	Positive regulation of cell cycle	IMP	20080953
GO:0045892	Process	Negative regulation of DNA-templated transcription	IDA	20080953
GO:0045892	Process	Negative regulation of DNA-templated transcription	IEA
GO:0045893	Process	Positive regulation of DNA-templated transcription	IDA	18845237, 19850744, 20080953
GO:0045893	Process	Positive regulation of DNA-templated transcription	IMP	19628791
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IBA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	9430642, 19850744, 19917671, 21131358
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IMP	20080953
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	ISS
GO:0046872	Function	Metal ion binding	IEA
GO:0048027	Function	MRNA 5'-UTR binding	IEA
GO:0048167	Process	Regulation of synaptic plasticity	IEA
GO:0048384	Process	Retinoic acid receptor signaling pathway	IBA
GO:0048384	Process	Retinoic acid receptor signaling pathway	IDA	9267036
GO:0048384	Process	Retinoic acid receptor signaling pathway	IDA	2825025, 19917671
GO:0048384	Process	Retinoic acid receptor signaling pathway	IEA
GO:0048384	Process	Retinoic acid receptor signaling pathway	IMP	17538076
GO:0048471	Component	Perinuclear region of cytoplasm	IEA
GO:0051018	Function	Protein kinase A binding	IDA	20215566
GO:0051099	Process	Positive regulation of binding	IMP	20080953
GO:0051393	Function	Alpha-actinin binding	IPI	22351778
GO:0055012	Process	Ventricular cardiac muscle cell differentiation	IEA
GO:0060010	Process	Sertoli cell fate commitment	IEA
GO:0060173	Process	Limb development	IEA
GO:0060324	Process	Face development	IEA
GO:0060348	Process	Bone development	IEA
GO:0060534	Process	Trachea cartilage development	IEA
GO:0060591	Process	Chondroblast differentiation	IEA
GO:0061037	Process	Negative regulation of cartilage development	IEA
GO:0071222	Process	Cellular response to lipopolysaccharide	IEA
GO:0071300	Process	Cellular response to retinoic acid	IMP	28122350
GO:0071391	Process	Cellular response to estrogen stimulus	IDA	20080953
GO:0071630	Process	Nuclear protein quality control by the ubiquitin-proteasome system	IDA	37478846
GO:0090575	Component	RNA polymerase II transcription regulator complex	IBA
GO:0090575	Component	RNA polymerase II transcription regulator complex	IDA	1310351
GO:0090575	Component	RNA polymerase II transcription regulator complex	NAS	9430642
GO:1901363	Function	Heterocyclic compound binding	IEA
GO:1901532	Process	Regulation of hematopoietic progenitor cell differentiation	IEA
GO:1902894	Process	Negative regulation of miRNA transcription	IMP	28122350
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IEA

MIM	HGNC	e!Ensembl
180240	9864	ENSG00000131759

P10276

Protein name

Retinoic acid receptor alpha (RAR-alpha) (Nuclear receptor subfamily 1 group B member 1)

Protein function

Receptor for retinoic acid (PubMed:16417524, PubMed:19850744, PubMed:20215566, PubMed:21152046, PubMed:37478846). Retinoic acid receptors bind as heterodimers to their target response elements in response to their ligands, all-trans or 9-cis ret

PDB

1DKF , 1DSZ , 3A9E , 3KMR , 3KMZ , 4DQM , 5K13 , 6XWG , 7AOS , 7APO , 7QAA , 7WQQ , 9GFE , 9GFI

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00105	zf-C4	86 → 155	Zinc finger, C4 type (two domains)	Domain
PF00104	Hormone_recep	224 → 401	Ligand-binding domain of nuclear hormone receptor	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in monocytes. {ECO:0000269|PubMed:26463675}.

Sequence

MASNSSSCPTPGGGHLNGYPVPPYAFFFPPMLGGLSPPGALTTLQHQLPVSGYSTPSPAT
IETQSSSSEEIVPSPPSPPPLPRIYKPCFVCQDKSSGYHYGVSACEGCKGFFRRSIQKNM
VYTCHRDKNCIINKVTRNRCQYCRLQKCFEVGMSKESVRNDRNKKKKEVPKPECSESYTL
TPEVGELIEKVRKAHQETFPALCQLGKYTTNNSSEQRVSLDIDLWDKFSELSTKCIIKTV
EFAKQLPGFTTLTIADQITLLKAACLDILILRICTRYTPEQDTMTFSDGLTLNRTQMHNA
GFGPLTDLVFAFANQLLPLEMDDAETGLLSAICLICGDRQDLEQPDRVDMLQEPLLEALK
VYVRKRRPSRPHMFPKMLMKITDLRSISAKGAERVITLKMEIPGSMPPLIQEMLENSEGL
DTLSGQPGGGGRDGGGLAPPPGSCSPSLSPSSNRSSPATHSP

Sequence length

462

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (13)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
BREAST NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, HEPATOCELLULAR	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CENTRAL NERVOUS SYSTEM CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DYSLIPIDEMIAS	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOBLASTOMA MULTIFORME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LEUKEMIA, PROMYELOCYTIC, ACUTE	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mendelian syndromes with cleft lip/palate	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MOOD DISORDERS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OROFACIAL CLEFTING SYNDROME	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Syndromic disease	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Tretinoin response	Uncertain significance; drug response	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (251)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Acute Erythroblastic Leukemia	Erythroblastic Leukemia	BEFREE	7529139		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute leukemia	Leukemia	BEFREE	8654368		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	16273555, 8152281, 8392400		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute monocytic leukemia	Monocytic Leukemia	BEFREE	20362228, 24449212, 8194047		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute Myeloid Leukemia (AML-M2)	Leukemia	BEFREE	10221524		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute Promyelocytic Leukemia	Promyelocytic Leukemia	BEFREE	10203104, 10330422, 10360373, 10373566, 10381496, 10397747, 10439807, 10498880, 10564584, 10597230, 10601023, 10669754, 10688654, 10702899, 10753851 View all (442 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute Promyelocytic Leukemia	Promyelocytic Leukemia	CTD_human_DG	10742073, 14508522, 14706140, 16239915, 16788101, 16835227, 16891316, 16935935, 17294898, 17649720, 17712046, 19029980, 19035177, 19884644, 19887701 View all (8 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute Promyelocytic Leukemia	Promyelocytic Leukemia	ORPHANET_DG	10942371		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute promyelocytic leukemia	Promyelocytic Leukemia	Orphanet			★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute Promyelocytic Leukemia	Promyelocytic Leukemia	LHGDN	11891284, 11929748, 12060771, 12505266, 16113082, 16728697, 18212063, 18636556, 19029980, 19100514		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute Promyelocytic Leukemia	Promyelocytic Leukemia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	11231454, 8398710		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma Of Esophagus	Esophageal Cancer	BEFREE	23280144		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Acute Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	8392400		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Acute Myeloblastic Leukemia	Myeloblastic Leukemia	BEFREE	28735486		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	29848990	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia	Anemia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	24729540		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anorexia	Anorexia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	29459264, 31359395		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	24089231	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	28944907		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	19628791	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	29459264, 31359395		★★★★★ ★☆☆☆☆ Found in Text Mining only
ATRICHIA WITH PAPULAR LESIONS	Atrichia With Papular Lesions	BEFREE	10360373, 10940477, 11704850, 15179005, 16504291, 20935222, 23509325, 24907012, 25258343, 26058416, 27605212, 28129653, 28486101, 30674471, 7719245 View all (7 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Attention deficit hyperactivity disorder	Attention Deficit Hyperactivity Disorder	BEFREE	15635645		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	BEFREE	15635645		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	37597518	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune thyroiditis	Autoimmune Thyroiditis	BEFREE	31579073		★★★★★ ★☆☆☆☆ Found in Text Mining only
B Acute Lymphoblastic Leukemia with t(9;22)(q34.1;q11.2); BCR-ABL1	Lymphoblastic Leukemia	BEFREE	28654205		★★★★★ ★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	25088254		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar Disorder	BEFREE	15635645		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	22286019		★★★★★ ★☆☆☆☆ Found in Text Mining only
Blood Coagulation Disorders	Blood Coagulation Disorders	BEFREE	1317727, 20133705		★★★★★ ★☆☆☆☆ Found in Text Mining only
Blood Coagulation Disorders	Blood coagulation disorder	Pubtator	1317727, 20133705	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Borderline Personality Disorder	Borderline personality disorder	BEFREE	15635645		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	10814678, 11141504, 11501579, 15171703, 15375546, 17608728, 18592373, 18650449, 18705646, 19240236, 20100636, 20453882, 20804918, 20865461, 21299862 View all (12 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	CTD_human_DG	26437033		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	10364250, 17998817, 18332872, 18650449, 20080953, 21288332, 21299862, 22084256, 23474897, 23868472, 25287138, 26313912, 27894085, 28350049, 28692043 View all (6 more)	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bronchopulmonary Dysplasia	Bronchopulmonary Dysplasia	BEFREE	15635645		★★★★★ ★☆☆☆☆ Found in Text Mining only
Calcinosis	Calcinosis	Pubtator	31852220	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	10389997	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	25300573, 7858248	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	15080786, 30155836		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Adenoid Cystic	Adenoid cystic carcinoma	Pubtator	37040084	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	24564241, 33090723	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	22286019, 22992440		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	10717330, 15657432, 19961602, 27932034, 30532072		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	16012182	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	11077050	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	8460637		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	28724938		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	9718082		★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	18665825, 19142993, 20211010, 8392400		★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood Acute Myeloid Leukemia	Acute Myeloid Leukemia	BEFREE	28735486		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholestasis	Cholestasis	BEFREE	25798860		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholestasis	Cholelithiasis	Pubtator	25798860	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	29719094		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	28780376		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic myeloproliferative disorder	Myeloproliferative disorder	BEFREE	9144232		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cleft Lip	Cleft lip	Pubtator	1361101	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cleft Lip with or without Cleft Palate	Cleft Lip With Or Without Cleft Palate	BEFREE	12111375		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cleft Palate	Cleft palate	Pubtator	7485164	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Coloboma of the Retina	Retinal coloboma	BEFREE	31343737		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	15526363, 27301432, 30155836, 30410666		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	28483913, 33472949	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital absence of kidney	Renal agenesis	BEFREE	28739660		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital absence of kidneys syndrome	Renal agenesis	BEFREE	28739660		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital chromosomal disease	Congenital Chromosomal Disease	BEFREE	10602411, 11929790, 16080957, 16239915, 24488785, 26079545, 8274449		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital ocular coloboma (disorder)	Congenital ocular coloboma	BEFREE	31343737		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital ocular coloboma (disorder)	Congenital ocular coloboma	GENOMICS_ENGLAND_DG	31343737		★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	24821727		★★★★★ ★☆☆☆☆ Found in Text Mining only
Craniosynostoses	Craniosynostosis	Pubtator	37086723	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	30710527		★★★★★ ★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	24089231		★★★★★ ★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	19596122, 28488270, 30711623		★★★★★ ★☆☆☆☆ Found in Text Mining only
Developmental Disabilities	Development Disorder	BEFREE	21984809		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	30910956	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diffuse alveolar hemorrhage	Diffuse alveolar hemorrhage	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	9009083		★★★★★ ★☆☆☆☆ Found in Text Mining only
Disseminated Intravascular Coagulation	Disseminated Intravascular Coagulation	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down Syndrome	BEFREE	15193435		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	28375930		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	21310893, 28375930	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	15824151, 20426865, 30155836		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	15824151, 20426865		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophagitis	Esotropia	Pubtator	11315258	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty Liver	BEFREE	31109648, 7837930		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibrinogen Deficiency	Fibrinogen Deficiency	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibroadenoma	Fibroadenoma	BEFREE	20865461, 26437033, 31647027		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibroadenoma	Fibroadenoma	CTD_human_DG	26437033		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	27791279		★★★★★ ★☆☆☆☆ Found in Text Mining only
Focal glomerulosclerosis	Glomerulosclerosis	BEFREE	22351778		★★★★★ ★☆☆☆☆ Found in Text Mining only
Follicular thyroid carcinoma	Follicular Thyroid Carcinoma	BEFREE	15080786		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fundus coloboma	Fundus Coloboma	BEFREE	31343737		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gangrene	Gangrene	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastrointestinal Neoplasms	Gastrointestinal neoplasm	Pubtator	32883271	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	30496014		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	30496014		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glomerulonephritis	Glomerulonephritis	BEFREE	28756872		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glomerulonephritis IGA	Iga nephropathy	Pubtator	20957306	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glomerulosclerosis (disorder)	Glomerulosclerosis	BEFREE	28645189		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glomerulosclerosis Focal Segmental	Focal segmental glomerulosclerosis	Pubtator	22351778	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Graft vs Host Disease	Graft-versus-host disease	Pubtator	32905596	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Graves Ophthalmopathy	Graves ophthalmopathy	Pubtator	29791662	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hashimoto Disease	Hashimoto Disease	BEFREE	31579073		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hematologic Diseases	Hematologic disease	Pubtator	8639801, 9680345	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic Neoplasms	BEFREE	20804918		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemorrhoids	Hemorrhoids	BEFREE	31264350		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	12200354, 8669476	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	30677086		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperlipidemias	Hyperlipidemia	Pubtator	37947652	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperlipoproteinemia Type II	Hyperlipoproteinemia	Pubtator	8634442	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperopia	Hyperopia	BEFREE	19626135		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypofibrinogenemia	Hypofibrinogenemia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypothyroidism	Hypothyroidism	BEFREE	30761678		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypothyroidism	Hypothyroidism	Pubtator	37947652	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ichthyosis, X-Linked	Ichthyosis	BEFREE	17359542		★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	20451601	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	BEFREE	25369030		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	35275975	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intestinal Diseases	Intestinal disease	Pubtator	10389997	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Keratoderma, Palmoplantar	Palmoplantar keratoderma	BEFREE	7504553		★★★★★ ★☆☆☆☆ Found in Text Mining only
Keratoderma, Palmoplantar, Diffuse	Palmoplantar keratoderma	BEFREE	7504553		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	28645189		★★★★★ ★☆☆☆☆ Found in Text Mining only
Laryngeal Neoplasms	Laryngeal neoplasm	Pubtator	28122350	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Laryngeal Squamous Cell Carcinoma	Laryngeal Carcinoma	BEFREE	29344234		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lesion of Sciatic Nerve	Lesion Of Sciatic Nerve	CTD_human_DG	16782282		★★★★★ ★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	10441338, 11342307, 11358384, 11561158, 11929790, 12127726, 12393450, 12935958, 14566333, 18408763, 18650449, 19029980, 19748670, 19901261, 20060365 View all (16 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	10601023, 12213824, 1372989, 15729358, 16449642, 18650449, 19451220, 2175343, 23898169, 24516348, 2546626, 35963522, 7858248, 8514604, 8634447, 9256429, 9269772, 9593784, 9716606 View all (4 more)	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	LHGDN	11106752, 14737102, 16540467, 17252005		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid	Myeloid leukemia	Pubtator	10068679, 10192433, 12393712, 1670759, 19451220, 1970118, 20826193, 30225259, 8530518	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	10233384, 10940650, 10942402, 11552979, 12130525, 15729358, 16630339, 17177193, 17993618, 18000064, 20739655, 23091311, 23547873, 23941359, 24769646 View all (21 more)	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Promyelocytic Acute	Promyelocytic leukemia	Pubtator	10029573, 10225671, 10233384, 10553155, 10601023, 10627441, 10669754, 10753851, 10940650, 10942370, 10942371, 10942402, 11023521, 11050004, 11090081 View all (190 more)	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	10192433, 11172539, 11313705, 11896540, 12791658, 14739224, 16645213, 16984370, 17361223, 17993618, 18422993, 18665825, 18692690, 18832181, 19451695 View all (39 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	LHGDN	17993618		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukopenia	Leukopenia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Lipoid nephrosis	Lipoid Nephrosis	BEFREE	21150871		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	10766424, 2172793, 22521346, 23474497, 24564241, 28035062		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	CTD_human_DG	18026104		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Diseases	Liver disease	Pubtator	21272161	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Failure	Liver failure	Pubtator	17272513	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	26557664	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	10192433	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	16273555, 8562957		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma, T-Cell, Cutaneous	Lymphoma	BEFREE	25826424, 28370539, 28412739		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Cystosarcoma Phyllodes	Cystosarcoma Phyllodes	CTD_human_DG	26437033		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	10814678, 11141504, 11501579, 15171703, 15375546, 17608728, 18592373, 18650449, 18705646, 19240236, 20100636, 20453882, 20804918, 20865461, 21299862 View all (11 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	CTD_human_DG	26437033		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	28375930		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	15824151, 20426865		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	21768647		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	10717330, 15657432, 19961602, 27932034, 30532072, 8950166		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	8460637		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	23178525, 26886237, 30828077		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	30123134		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	22286019		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	10192433, 10814678, 12032336, 1323988, 15171703, 15824151, 15988048, 16473273, 16849557, 17283134, 17706161, 18048326, 18941112, 20453882, 20574048 View all (14 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Carcinoma, Human	Marfan Syndrome	CTD_human_DG	26437033		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	12420222, 15831516		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	20453882, 21299862, 8261407		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	CTD_human_DG	26437033		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms, Human	Mammary Neoplasms	CTD_human_DG	26437033		★★★★★ ★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	Pubtator	19966297	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	15064737, 9169003		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	20548792, 9228081	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Meningomyelocele	Meningomyelocele	BEFREE	21254357		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	19596122, 28488270, 30711623		★★★★★ ★☆☆☆☆ Found in Text Mining only
Microcephaly	Microcephaly	BEFREE	25250690		★★★★★ ★☆☆☆☆ Found in Text Mining only
Miller Dieker syndrome	Miller Dieker Syndrome	BEFREE	23147462		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mood Disorders	Mood Disorder	BEFREE	19596122		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mood Disorders	Mood Disorder	PSYGENET_DG	19596122		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Myeloma	Multiple myeloma	BEFREE	17229644		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	17229644	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	18650449, 23955709		★★★★★ ★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	16984370, 20222800, 23147462, 24875590		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndromes	Myelodysplastic syndrome	Pubtator	10192433, 11122147, 36130886, 36477975, 37571998, 38418133	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia	Myeloid Leukemia	BEFREE	11607822, 11929790, 1670759, 18408763, 19855079, 22714999, 27035679, 8193361		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	8152281, 8180390, 8392400		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myeloproliferative disease	Myeloproliferative disorder	BEFREE	18408763, 21364283, 21436584, 9144232		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myopia	Myopia	BEFREE	19626135		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myopia	Myopia	Pubtator	19626135	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10441338, 10814678, 11141504, 11501579, 11945179, 15289362, 15604252, 15766561, 15788661, 17108214, 17172828, 17549354, 17608728, 17998817, 18592373 View all (19 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephroblastoma	Nephroblastoma	BEFREE	15526363, 29378601, 7700638		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuralgia-Neuritis, Sciatic Nerve	Sciatic Nerve Neuralgia-Neuritis	CTD_human_DG	16782282		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	1315216, 15520197, 22022577, 25963741, 28216044, 7786028, 8382032, 9169003		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	25963741, 32149119	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neutropenia	Neutropenia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	30677086		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	12911822, 27306217		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	Pubtator	25815782	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	22135230		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	24608861, 32916897	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	8460637		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	16012182	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Palmoplantar Keratosis	Palmoplantar Keratosis	BEFREE	7504553		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	10938282, 29169171	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancytopenia	Pancytopenia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	23969901, 31579073		★★★★★ ★☆☆☆☆ Found in Text Mining only
Peripheral T-Cell Lymphoma	T-Cell Lymphoma	BEFREE	28412739		★★★★★ ★☆☆☆☆ Found in Text Mining only
Phyllodes Tumor	Phyllodes Tumor	BEFREE	26437033		★★★★★ ★☆☆☆☆ Found in Text Mining only
Phyllodes Tumor	Phyllodes Tumor	CTD_human_DG	26437033		★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	BEFREE	16273555, 8152281		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	23178525, 26886237, 30828077		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Hyperplasia	Prostatic hyperplasia	Pubtator	12399530	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Intraepithelial Neoplasia	Prostatic intraepithelial neoplasia	Pubtator	12399530	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	12399530, 30828077, 32881426	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	17960617		★★★★★ ★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	31837302		★★★★★ ★☆☆☆☆ Found in Text Mining only
Refractory anemias	Anemia	BEFREE	10373566, 11561158, 14976209, 28570942, 29160747, 29246089, 30760627, 7519122, 8755574, 9462740		★★★★★ ★☆☆☆☆ Found in Text Mining only
RENAL ADYSPLASIA	Renal Aplasia	BEFREE	28739660		★★★★★ ★☆☆☆☆ Found in Text Mining only
Reticulosarcoma	Reticulosarcoma	BEFREE	9009083		★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	BEFREE	15613498		★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	Pubtator	33935126, 9260893	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	Pubtator	25915942	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	10373566, 11561158, 14976209, 28570942, 29160747, 29246089, 30760627, 7519122, 8755574, 9462740		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	BEFREE	9816019		★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	15635645, 15698673, 24564241		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	PSYGENET_DG	15635645, 15698673, 24564241		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	Pubtator	24564241, 28696354	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sciatic Nerve Palsy	Sciatic Nerve Palsy	CTD_human_DG	16782282		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sciatic Neuritis	Sciatic Neuritis	CTD_human_DG	16782282		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sciatic Neuropathy	Sciatic Neuropathy	CTD_human_DG	16782282		★★★★★ ★☆☆☆☆ Found in Text Mining only
Seminoma	Seminoma	BEFREE	24821727		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sepsis	Sepsis	Pubtator	33949285	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Skin Diseases	Skin disease	Pubtator	33203692	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Skin Neoplasms	Skin Neoplasms	BEFREE	19058256		★★★★★ ★☆☆☆☆ Found in Text Mining only
Smith-Magenis syndrome	Smith-Magenis Syndrome	BEFREE	17050068, 21947821, 27893937		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	10415749, 11945179		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	LHGDN	15255287		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	27689360, 31350847		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	17549354		★★★★★ ★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	31109648, 7837930		★★★★★ ★☆☆☆☆ Found in Text Mining only
Steroid Sulfatase Deficiency Disease	Steroid Sulfatase Deficiency Disease	BEFREE	17359542		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	28035062, 30123134		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	10389997	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	11819850, 22901127	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomatitis	Stomatitis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
T-Cell Lymphoma	T-Cell Lymphoma	BEFREE	28412739		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	25908172	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	19155317		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Hormone Resistance Syndrome	Thyroid hormone resistance	Pubtator	7913468	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	23969901		★★★★★ ★☆☆☆☆ Found in Text Mining only
Treatment related secondary malignancy	Treatment Related Secondary Malignancy	CTD_human_DG	19884644		★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	28350049, 37093683	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	29849791		★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	21736279	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Varicocele	Varicocele	BEFREE	24992177, 29943815		★★★★★ ★☆☆☆☆ Found in Text Mining only
Vitamin A Deficiency	Vitamin A Deficiency	BEFREE	29534734		★★★★★ ★☆☆☆☆ Found in Text Mining only
Von Hippel-Lindau Syndrome	Von Hippel-Lindau Syndrome	BEFREE	15526363		★★★★★ ★☆☆☆☆ Found in Text Mining only
Wilms Tumor	Wilms tumor	Pubtator	29378601	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

RARA (retinoic acid receptor alpha)