RAPGEF3 (Rap guanine nucleotide exchange factor 3)

Gene

• Entrez ID: 10411
• Gene name: Rap guanine nucleotide exchange factor 3
• Gene symbol: RAPGEF3
• Synonyms (NCBI Gene): CAMP-GEFI, EPAC, EPAC1, HSU79275, bcm910
• Chromosome: 12
• Chromosome location: 12q13.11

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT019181	hsa-miR-335-5p	Microarray	18185580
MIRT023183	hsa-miR-124-3p	Microarray	18668037
MIRT527554	hsa-miR-6782-3p	PAR-CLIP	22012620
MIRT527553	hsa-miR-4714-3p	PAR-CLIP	22012620
MIRT527552	hsa-miR-4286	PAR-CLIP	22012620
MIRT527551	hsa-miR-4290	PAR-CLIP	22012620
MIRT735923	hsa-miR-7-5p	Luciferase reporter assay, Western blotting, qRT-PCR	33553184
MIRT527554	hsa-miR-6782-3p	PAR-CLIP	22012620
MIRT527553	hsa-miR-4714-3p	PAR-CLIP	22012620
MIRT527552	hsa-miR-4286	PAR-CLIP	22012620
MIRT527551	hsa-miR-4290	PAR-CLIP	22012620
MIRT1290767	hsa-miR-1343	CLIP-seq
MIRT1290768	hsa-miR-2276	CLIP-seq
MIRT1290769	hsa-miR-3074-5p	CLIP-seq
MIRT1290770	hsa-miR-3173-3p	CLIP-seq
MIRT1290771	hsa-miR-3682-3p	CLIP-seq
MIRT1290772	hsa-miR-4270	CLIP-seq
MIRT1290773	hsa-miR-4419a	CLIP-seq
MIRT1290774	hsa-miR-4434	CLIP-seq
MIRT1290775	hsa-miR-4441	CLIP-seq
MIRT1290776	hsa-miR-4502	CLIP-seq
MIRT1290777	hsa-miR-4510	CLIP-seq
MIRT1290778	hsa-miR-4516	CLIP-seq
MIRT1290779	hsa-miR-4685-5p	CLIP-seq
MIRT1290780	hsa-miR-4763-5p	CLIP-seq
MIRT1290781	hsa-miR-4779	CLIP-seq
MIRT1290782	hsa-miR-515-3p	CLIP-seq
MIRT1290783	hsa-miR-519e	CLIP-seq
MIRT1290784	hsa-miR-550a	CLIP-seq
MIRT1290785	hsa-miR-635	CLIP-seq
MIRT1290786	hsa-miR-765	CLIP-seq
MIRT1290787	hsa-miR-766	CLIP-seq
MIRT1290788	hsa-miR-1205	CLIP-seq
MIRT1290789	hsa-miR-1207-5p	CLIP-seq
MIRT1290790	hsa-miR-1233	CLIP-seq
MIRT1290791	hsa-miR-1266	CLIP-seq
MIRT1290792	hsa-miR-1269	CLIP-seq
MIRT1290793	hsa-miR-1269b	CLIP-seq
MIRT1290794	hsa-miR-1288	CLIP-seq
MIRT1290795	hsa-miR-1293	CLIP-seq
MIRT1290796	hsa-miR-1909	CLIP-seq
MIRT1290797	hsa-miR-2117	CLIP-seq
MIRT1290798	hsa-miR-3127-5p	CLIP-seq
MIRT1290799	hsa-miR-3155	CLIP-seq
MIRT1290800	hsa-miR-3155b	CLIP-seq
MIRT1290801	hsa-miR-3179	CLIP-seq
MIRT1290802	hsa-miR-3187-3p	CLIP-seq
MIRT1290803	hsa-miR-323-5p	CLIP-seq
MIRT1290804	hsa-miR-3607-3p	CLIP-seq
MIRT1290805	hsa-miR-3612	CLIP-seq
MIRT1290806	hsa-miR-370	CLIP-seq
MIRT1290807	hsa-miR-378	CLIP-seq
MIRT1290808	hsa-miR-378b	CLIP-seq
MIRT1290809	hsa-miR-378c	CLIP-seq
MIRT1290810	hsa-miR-378d	CLIP-seq
MIRT1290811	hsa-miR-378e	CLIP-seq
MIRT1290812	hsa-miR-378f	CLIP-seq
MIRT1290813	hsa-miR-378h	CLIP-seq
MIRT1290814	hsa-miR-378i	CLIP-seq
MIRT1290815	hsa-miR-3918	CLIP-seq
MIRT1290816	hsa-miR-422a	CLIP-seq
MIRT1290817	hsa-miR-4254	CLIP-seq
MIRT1290818	hsa-miR-4283	CLIP-seq
MIRT1290819	hsa-miR-4308	CLIP-seq
MIRT1290820	hsa-miR-4435	CLIP-seq
MIRT1290821	hsa-miR-4443	CLIP-seq
MIRT1290822	hsa-miR-4483	CLIP-seq
MIRT1290823	hsa-miR-4515	CLIP-seq
MIRT1290824	hsa-miR-4518	CLIP-seq
MIRT1290825	hsa-miR-4527	CLIP-seq
MIRT1290826	hsa-miR-4638-3p	CLIP-seq
MIRT1290827	hsa-miR-4645-5p	CLIP-seq
MIRT1290828	hsa-miR-4673	CLIP-seq
MIRT1290829	hsa-miR-4688	CLIP-seq
MIRT1290830	hsa-miR-4701-5p	CLIP-seq
MIRT1290831	hsa-miR-4707-3p	CLIP-seq
MIRT1290832	hsa-miR-4740-5p	CLIP-seq
MIRT1290833	hsa-miR-4755-3p	CLIP-seq
MIRT1290834	hsa-miR-4763-3p	CLIP-seq
MIRT1290835	hsa-miR-4768-5p	CLIP-seq
MIRT1290836	hsa-miR-484	CLIP-seq
MIRT1290837	hsa-miR-486-3p	CLIP-seq
MIRT1290838	hsa-miR-510	CLIP-seq
MIRT1290839	hsa-miR-512-3p	CLIP-seq
MIRT1290840	hsa-miR-548s	CLIP-seq
MIRT1290841	hsa-miR-588	CLIP-seq
MIRT1290842	hsa-miR-604	CLIP-seq
MIRT1290843	hsa-miR-647	CLIP-seq
MIRT1290844	hsa-miR-650	CLIP-seq
MIRT1290787	hsa-miR-766	CLIP-seq
MIRT2086495	hsa-miR-513a-5p	CLIP-seq
MIRT2311557	hsa-miR-1228	CLIP-seq
MIRT2311558	hsa-miR-1248	CLIP-seq
MIRT2311559	hsa-miR-1301	CLIP-seq
MIRT2311560	hsa-miR-214	CLIP-seq
MIRT2311561	hsa-miR-3064-5p	CLIP-seq
MIRT2311562	hsa-miR-3119	CLIP-seq
MIRT2311563	hsa-miR-3140-3p	CLIP-seq
MIRT2311564	hsa-miR-3619-5p	CLIP-seq
MIRT2311565	hsa-miR-3652	CLIP-seq
MIRT2311566	hsa-miR-4274	CLIP-seq
MIRT2311567	hsa-miR-4291	CLIP-seq
MIRT2311568	hsa-miR-4430	CLIP-seq
MIRT2311569	hsa-miR-4505	CLIP-seq
MIRT2311570	hsa-miR-4650-5p	CLIP-seq
MIRT2311571	hsa-miR-4659a-3p	CLIP-seq
MIRT2311572	hsa-miR-4659b-3p	CLIP-seq
MIRT2311573	hsa-miR-4660	CLIP-seq
MIRT2311574	hsa-miR-4778-3p	CLIP-seq
MIRT2311575	hsa-miR-5047	CLIP-seq
MIRT2311576	hsa-miR-761	CLIP-seq
MIRT2311577	hsa-miR-922	CLIP-seq
MIRT2311578	hsa-miR-942	CLIP-seq
MIRT2457750	hsa-miR-124	CLIP-seq
MIRT2457751	hsa-miR-3065-5p	CLIP-seq
MIRT2457752	hsa-miR-3714	CLIP-seq
MIRT2457753	hsa-miR-3910	CLIP-seq
MIRT1290826	hsa-miR-4638-3p	CLIP-seq
MIRT2457754	hsa-miR-4786-3p	CLIP-seq
MIRT2457755	hsa-miR-506	CLIP-seq
MIRT2457756	hsa-miR-885-3p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0001525	Process	Angiogenesis	IEA
GO:0002250	Process	Adaptive immune response	IEA
GO:0002250	Process	Adaptive immune response	TAS
GO:0005085	Function	Guanyl-nucleotide exchange factor activity	EXP	15334074, 16076873
GO:0005085	Function	Guanyl-nucleotide exchange factor activity	IBA
GO:0005085	Function	Guanyl-nucleotide exchange factor activity	IEA
GO:0005085	Function	Guanyl-nucleotide exchange factor activity	IMP	21840392
GO:0005085	Function	Guanyl-nucleotide exchange factor activity	TAS	9853756
GO:0005515	Function	Protein binding	IPI	21393242
GO:0005886	Component	Plasma membrane	IDA	21047789
GO:0005886	Component	Plasma membrane	TAS
GO:0005902	Component	Microvillus	IDA	21047789
GO:0007165	Process	Signal transduction	TAS	9853756
GO:0007189	Process	Adenylate cyclase-activating G protein-coupled receptor signaling pathway	NAS	16177794
GO:0007264	Process	Small GTPase-mediated signal transduction	IEA
GO:0007265	Process	Ras protein signal transduction	IBA
GO:0008306	Process	Associative learning	IEA
GO:0012505	Component	Endomembrane system	IEA
GO:0016020	Component	Membrane	IEA
GO:0016020	Component	Membrane	TAS	10777494
GO:0019904	Function	Protein domain specific binding	IPI	21047789
GO:0030027	Component	Lamellipodium	IDA	21047789
GO:0030175	Component	Filopodium	IDA	21047789
GO:0030552	Function	CAMP binding	IEA
GO:0030552	Function	CAMP binding	TAS
GO:0030864	Component	Cortical actin cytoskeleton	IDA	21047789
GO:0032486	Process	Rap protein signal transduction	IMP	21840392
GO:0032956	Process	Regulation of actin cytoskeleton organization	IMP	21840392
GO:0034242	Process	Negative regulation of syncytium formation by plasma membrane fusion	IMP	23867755
GO:0035556	Process	Intracellular signal transduction	IEA
GO:0035556	Process	Intracellular signal transduction	IMP	23867755
GO:0043491	Process	Phosphatidylinositol 3-kinase/protein kinase B signal transduction	IMP	21840392
GO:0043547	Process	Positive regulation of GTPase activity	IMP	21840392
GO:0045765	Process	Regulation of angiogenesis	IMP	21840392
GO:0045765	Process	Regulation of angiogenesis	IMP	21840392
GO:0045766	Process	Positive regulation of angiogenesis	IMP	21393242
GO:0046827	Process	Positive regulation of protein export from nucleus	IDA	23867755
GO:0050796	Process	Regulation of insulin secretion	TAS
GO:0051496	Process	Positive regulation of stress fiber assembly	IMP	21840392
GO:0051896	Process	Regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	IMP	21840392
GO:0060143	Process	Positive regulation of syncytium formation by plasma membrane fusion	IMP	23867755
GO:0061028	Process	Establishment of endothelial barrier	IMP	21840392
GO:0070062	Component	Extracellular exosome	HDA	19056867
GO:0071320	Process	Cellular response to cAMP	IDA	21840392

Other IDs

• MIM: 606057
• HGNC: 16629
• e!Ensembl: ENSG00000079337

Protein

• UniProt ID: O95398
• Protein name: Rap guanine nucleotide exchange factor 3 (Exchange factor directly activated by cAMP 1) (Exchange protein directly activated by cAMP 1) (EPAC 1) (Rap1 guanine-nucleotide-exchange factor directly activated by cAMP) (cAMP-regulated guanine nucleotide exchan
• Protein function: Guanine nucleotide exchange factor (GEF) for RAP1A and RAP2A small GTPases that is activated by binding cAMP. Through simultaneous binding of PDE3B to RAPGEF3 and PIK3R6 is assembled in a signaling complex in which it activates the PI3K gamma co
• PDB: 6H7E
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00610	DEP	114 → 184	Domain found in Dishevelled, Egl-10, and Pleckstrin (DEP)	Domain
  PF00027	cNMP_binding	265 → 348	Cyclic nucleotide-binding domain	Domain
  PF00618	RasGEF_N	387 → 493	RasGEF N-terminal motif	Domain
  PF00617	RasGEF	665 → 843	RasGEF domain	Family

• Tissue specificity: TISSUE SPECIFICITY: Widely expressed with highest levels in adult kidney, heart, thyroid and brain, and fetal kidney. {ECO:0000269|PubMed:9856955}.
• Sequence:

  MKVGWPGESCWQVGLAVEDSPALGAPRVGALPDVVPEGTLLNMVLRRMHRPRSCSYQLLL
  EHQRPSCIQGLRWTPLTNSEESLDFSESLEQASTERVLRAGRQLHRHLLATCPNLIRDRK
  YHLRLYRQCCSGRELVDGILALGLGVHSRSQVVGICQVLLDEGALCHVKHDWAFQDRDAQ
  FYRFPGPEPEPVRTHEMEEELAEAVALLSQRGPDALLTVALRKPPGQRTDEELDLIFEEL
  LHIKAVAHLSNSVKRELAAVLLFEPHSKAGTVLFSQGDKGTSWYIIWKGSVNVVTHGKGL
  VTTLHEGDDFGQLALVNDAPRAATIILREDNCHFLRVDKQDFNRIIKDVEAKTMRLEEHG
  KVVLVLERASQGAGPSRPPTPGRNRYTVMSGTPEKILELLLEAMGPDSSAHDPTETFLSD
  FLLTHRVFMPSAQLCAALLHHFHVEPAGGSEQERSTYVCNKRQQILRLVSQWVALYGSML
  HTDPVATSFLQKLSDLVGRDTRLSNLLREQWPERRRCHRLENGCGNASPQMKARNLPVWL
  PNQDEPLPGSSCAIQVGDKVPYDICRPDHSVLTLQLPVTASVREVMAALAQEDGWTKGQV
  LVKVNSAGDAIGLQPDARGVATSLGLNERLFVVNPQEVHELIPHPDQLGPTVGSAEGLDL
  VSAKDLAGQLTDHDWSLFNSIHQVELIHYVLGPQHLRDVTTANLERFMRRFNELQYWVAT
  ELCLCPVPGPRAQLLRKFIKLAAHLKEQKNLNSFFAVMFGLSNSAISRLAHTWERLPHKV
  RKLYSALERLLDPSWNHRVYRLALAKLSPPVIPFMPLLLKDMTFIHEGNHTLVENLINFE
  KMRMMARAARMLHHCRSHNPVPLSPLRSRVSHLHEDSQVARISTCSEQSLSTRSPASTWA
  YVQQLKVIDNQRELSRLSRELEP

• Sequence length: 923

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
Acute myeloid leukemia	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervical cancer	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC OBSTRUCTIVE AIRWAY DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Clear cell carcinoma of kidney	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colon adenocarcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatocellular carcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPOTHYROIDISM	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
KIDNEY FAILURE, ACUTE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung cancer	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of esophagus	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PULMONARY DISEASE, CHRONIC OBSTRUCTIVE	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thyroid cancer, nonmedullary, 1	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute Kidney Insufficiency	Acute Kidney Insufficiency	CTD_human_DG	21745194		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of rectum	Adenocarcinoma Of Rectum	BEFREE	30809467		★☆☆☆☆ Found in Text Mining only
Anaplastic carcinoma	Anaplastic Carcinoma	BEFREE	25372777		★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety Disorder	BEFREE	19475578, 27598965		★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety disorder	Pubtator	19475578	Associate	★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety Disorder	BEFREE	19475578, 27598965		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	21426315, 31932625	Associate	★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial Fibrillation	BEFREE	30518738, 30915767		★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	29111327		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	28210903, 28755423		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	28755423	Stimulate	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	39270542	Associate	★☆☆☆☆ Found in Text Mining only
C9 Deficiency	C9 deficiency	Pubtator	33362237	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	24316969	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	25372777		★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	31514484	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	29111327		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	29528086		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	31316160, 31726720		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	31316160, 31726720	Associate	★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	23702312		★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	22363678, 30395484		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	CTD_human_DG	22363678		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Congestive heart failure	Congestive Heart Failure	BEFREE	30915767		★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic Fibrosis	BEFREE	27206858		★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	19475578, 27598965		★☆☆☆☆ Found in Text Mining only
Depressive Disorder	Major depressive disorder	Pubtator	19475578	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	31726720		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	31726720		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	31726720	Associate	★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic Retinopathy	BEFREE	28353063		★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	28771997		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	28771997		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	28771997	Associate	★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	28864467		★☆☆☆☆ Found in Text Mining only
Follicular thyroid carcinoma	Follicular Thyroid Carcinoma	BEFREE	29289659, 29882482		★☆☆☆☆ Found in Text Mining only
Frontotemporal Dementia	Frontotemporal dementia	Pubtator	33362237	Associate	★☆☆☆☆ Found in Text Mining only
Hearing Loss	Hearing loss	Pubtator	36656851	Associate	★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart Diseases	BEFREE	30873562, 31795450		★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	30915767		★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	27598965		★☆☆☆☆ Found in Text Mining only
Kidney Failure, Acute	Kidney Failure	CTD_human_DG	21745194		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung Neoplasms	Lung neoplasms	Pubtator	23523631, 27534532, 28232663, 29528086	Associate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	29528086	Associate	★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	28210903, 28755423		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	28771997		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	29528086		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	23646189		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	28260059		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	29111327		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	27374176, 28283242, 29111327, 29375750, 29528086, 29982410, 30809467		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	20551063, 24725364, 28851815		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	24725364	Associate	★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	19475578, 27598965		★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic syndrome	Pubtator	38195707	Associate	★☆☆☆☆ Found in Text Mining only
Metastatic melanoma	Metastatic Melanoma	BEFREE	20551063, 28851815		★☆☆☆☆ Found in Text Mining only
Mood Disorders	Mood Disorder	BEFREE	27598965		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	29982410		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	27709364		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	27381457, 27867203		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity	Obesity	CTD_human_DG	29273807		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity	Obesity	Pubtator	38195707	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	25372777		★☆☆☆☆ Found in Text Mining only
Pemphigus	Pemphigus	Pubtator	31681304	Associate	★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	LHGDN	17895245		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	23646189		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	19725049, 23646189	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	22363678	Inhibit	★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	30395484, 30988604	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	23306833		★☆☆☆☆ Found in Text Mining only
Rectal Carcinoma	Rectal Carcinoma	BEFREE	30809467		★☆☆☆☆ Found in Text Mining only
Renal fibrosis	Renal fibrosis	BEFREE	29216750		★☆☆☆☆ Found in Text Mining only
Retinal Diseases	Retinal Diseases	BEFREE	28353063, 28512254		★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	31551444		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	28260059		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	28260059	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid cancer, follicular	Thyroid cancer	BEFREE	29289659, 29882482		★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	25372777		★☆☆☆☆ Found in Text Mining only
Thyroid Gland Follicular Adenoma	Thyroid Gland Follicular Adenoma	BEFREE	25372777		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	25372777		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	29982410		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	29982410	Associate	★☆☆☆☆ Found in Text Mining only
Vascular Remodeling	Vascular remodeling	Pubtator	31316160	Associate	★☆☆☆☆ Found in Text Mining only
Ventricular arrhythmia	Ventricular arrhythmia	BEFREE	30518738		★☆☆☆☆ Found in Text Mining only