RAP1BL (RAP1B like (pseudogene))

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 643752
Gene name RAP1B like (pseudogene)
Gene symbol RAP1BL
Synonyms (NCBI Gene)
-
Chromosome 5
Chromosome location 5q13.3
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
19 Show/Hide all (19)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0000166 Function Nucleotide binding IEA
GO:0003924 Function GTPase activity IBA
GO:0003924 Function GTPase activity IEA
GO:0005525 Function GTP binding IBA
GO:0005525 Function GTP binding IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
HGNC 55079 N/A
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
A6NIZ1
Protein name Ras-related protein Rap-1b-like protein (EC 3.6.5.2)
Protein function Probable GTP-binding protein with intrinsic GTPase activity.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00071 Ras 5 → 167 Ras family Domain
Sequence 
MREYKLVVLGSRGVGKSALTVQFVQGIFVEKYDPTIEDSYREQVEVDAQQCMLEILDTAG
TEQFTAMRDLYMKNGQGFALVYSITAQSTFNDLQDLREQILRVKDTDDVPMILVGNKCDL
EDERVVGKEQGQNLARQWNNCAFLESSAKSKINVNEIFYDLVRQINRKTPVPGKARKKSS
CQLL
Sequence length 184
Interactions View interactions

No strongly related genes found yet for RAP1BL.

No additional diseases found yet through genes similar to RAP1BL.