RAMAC (RNA guanine-7 methyltransferase activating subunit)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene Gene ontology Other IDs Protein Related genes Diseases linked via similar genes

Gene

• Entrez ID: 83640
• Gene name: RNA guanine-7 methyltransferase activating subunit
• Gene symbol: RAMAC
• Synonyms (NCBI Gene): C15orf18, FAM103A1, HsT19360, RAM, RAMMET
• Chromosome: 15
• Chromosome location: 15q25.2

Gene ontology (GO) Show/Hide all (17)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003723	Function	RNA binding	HDA	22681889
GO:0003723	Function	RNA binding	IBA
GO:0003723	Function	RNA binding	IDA	22099306
GO:0003723	Function	RNA binding	IEA
GO:0005515	Function	Protein binding	IPI	22099306, 25416956, 27422871, 30021884, 32296183, 33961781
GO:0005634	Component	Nucleus	IDA	22099306
GO:0005634	Component	Nucleus	IEA
GO:0006370	Process	7-methylguanosine mRNA capping	IDA	22099306
GO:0006370	Process	7-methylguanosine mRNA capping	IEA
GO:0006397	Process	MRNA processing	IEA
GO:0008047	Function	Enzyme activator activity	IDA	27422871
GO:0031533	Component	MRNA capping enzyme complex	IBA
GO:0031533	Component	MRNA capping enzyme complex	IDA	27422871
GO:0031533	Component	MRNA capping enzyme complex	IEA
GO:0106005	Process	RNA 5'-cap (guanine-N7)-methylation	IEA
GO:0140677	Function	Molecular function activator activity	EXP	27422871
GO:0160130	Component	MRNA cap methyltransferase RNMT:RAMAC complex	IDA	22099306

Other IDs

• MIM: 614547
• HGNC: 31022
• e!Ensembl: ENSG00000169612

Protein

• UniProt ID: Q9BTL3
• Protein name: RNA guanine-N7 methyltransferase activating subunit (Protein FAM103A1) (RNA guanine-7 methyltransferase activating subunit) (RNMT-activating mRNA cap methyltransferase subunit) (RNMT-activating mini protein) (RAM)
• Protein function: Regulatory subunit of the mRNA-capping methyltransferase RNMT:RAMAC complex that methylates the N7 position of the added guanosine to the 5'-cap structure of mRNAs (PubMed:22099306, PubMed:27422871). Promotes the recruitment of the methyl donor,
• PDB: 5E8J
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF15320	RAM	10 → 87	mRNA cap methylation, RNMT-activating mini protein	Family

• Sequence:

  MTDTAEAVPKFEEMFASRFTENDKEYQEYLKRPPESPPIVEEWNSRAGGNQRNRGNRLQD
  NRQFRGRDNRWGWPSDNRSNQWHGRSWGNNYPQHRQEPYYPQQYGHYGYNQRPPYGYY

• Sequence length: 118

Related Genes

No strongly related genes found yet for RAMAC.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to RAMAC.