RAET1G (retinoic acid early transcript 1G)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 353091
Gene name Retinoic acid early transcript 1G
Gene symbol RAET1G
Synonyms (NCBI Gene)
ULBP5
Chromosome 6
Chromosome location 6q25.1
Summary This gene encodes a member of the major histocompatibility complex (MHC) class I family of proteins. Although the encoded protein includes C-terminal transmembrane and cytoplasmic domains, proteolytic processing results in the removal of these domains and
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
20 Show/Hide all (20)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0001916 Process Positive regulation of T cell mediated cytotoxicity IBA
GO:0002376 Process Immune system process IEA
GO:0002476 Process Antigen processing and presentation of endogenous peptide antigen via MHC class Ib IBA
GO:0002486 Process Antigen processing and presentation of endogenous peptide antigen via MHC class I via ER pathway, TAP-independent IBA
GO:0002729 Process Positive regulation of natural killer cell cytokine production IDA 18544572
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
609244 16795 ENSG00000203722
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q6H3X3
Protein name UL-16 binding protein 5 (Retinoic acid early transcript 1G protein)
Protein function [Isoform 1]: Binds and activates the KLRK1/NKG2D receptor, mediating natural killer cell cytotoxicity. ; [Isoform 3]: Down-regulates the expression
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00129 MHC_I 29 → 205 Class I Histocompatibility antigen, domains alpha 1 and 2 Domain
Tissue specificity TISSUE SPECIFICITY: Isoform 1 is highly expressed in colon and in a number of tumor cell lines and highly restricted in normal tissues. Both isoforms are frequently expressed in cell lines derived from epithelial cancers, and in primary breast cancers. {E
Sequence 
MAAAASPAFLLRLPLLLLLSSWCRTGLADPHSLCYDITVIPKFRPGPRWCAVQGQVDEKT
FLHYDCGSKTVTPVSPLGKKLNVTTAWKAQNPVLREVVDILTEQLLDIQLENYIPKEPLT
LQARMSCEQKAEGHGSGSWQLSFDGQIFLLFDSENRMWTTVHPGARKMKEKWENDKDMTM
SFHYISMGDCTGWLEDFLMGMDSTLEPSAGAPPTMSSGTAQPRATATTLILCCLLIMCLL
ICSRHSLTQSHGHHPQSLQPPPHPPLLHPTWLLRRVLWSDSYQIAKRPLSGGHVTRVTLP
IIGDDSHSLPCPLALYTINNGAARYSEPLQVSIS
Sequence length 334
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Download as csvDownload as pdf
KEGG Pathway Reactome Pathway
Natural killer cell mediated cytotoxicity Post-translational modification: synthesis of GPI-anchored proteins
Sort by:
RAET1L 2 shared pathwaysNatural killer cell mediated cytotoxicity, Post-translational modification: synthesis of GPI-anchored proteins Related via 2 shared pathways including Natural killer cell mediated cytotoxicity, Post-translational modification: synthesis of GPI-anchored proteins. ULBP2 2 shared pathwaysNatural killer cell mediated cytotoxicity, Post-translational modification: synthesis of GPI-anchored proteins Related via 2 shared pathways including Natural killer cell mediated cytotoxicity, Post-translational modification: synthesis of GPI-anchored proteins. FCGR3B 2 shared pathwaysNatural killer cell mediated cytotoxicity, Post-translational modification: synthesis of GPI-anchored proteins Related via 2 shared pathways including Natural killer cell mediated cytotoxicity, Post-translational modification: synthesis of GPI-anchored proteins.
Basal cell carcinoma Linked via 1 of 3 related genesRAET1L Keratinocyte carcinoma Linked via 1 of 3 related genesRAET1L Stomach neoplasms Linked via 1 of 3 related genesULBP2 Systemic scleroderma Linked via 1 of 3 related genesFCGR3B Allergic contact dermatitis Linked via 1 of 3 related genesFCGR3B