Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs Other IDs Associated diseases
Entrez ID	55698
Gene name	Rap associating with DIL domain
Gene symbol	RADIL
Synonyms (NCBI Gene)	RASIP2
Chromosome	7
Chromosome location	7p22.1

Show/Hide all (18)

miRTarBase ID	miRNA	Experiments	Reference
MIRT024802	hsa-miR-215-5p	Microarray	19074876
MIRT026743	hsa-miR-192-5p	Microarray	19074876
MIRT040348	hsa-miR-615-3p	CLASH	23622248
MIRT572363	hsa-miR-6746-3p	PAR-CLIP	20371350
MIRT572364	hsa-miR-6849-3p	PAR-CLIP	20371350
MIRT572362	hsa-miR-766-3p	PAR-CLIP	20371350
MIRT572361	hsa-miR-3925-3p	PAR-CLIP	20371350
MIRT572360	hsa-miR-4632-3p	PAR-CLIP	20371350
MIRT572359	hsa-miR-6512-3p	PAR-CLIP	20371350
MIRT572358	hsa-miR-6720-5p	PAR-CLIP	20371350
MIRT572363	hsa-miR-6746-3p	PAR-CLIP	20371350
MIRT572364	hsa-miR-6849-3p	PAR-CLIP	20371350
MIRT572362	hsa-miR-766-3p	PAR-CLIP	20371350
MIRT572361	hsa-miR-3925-3p	PAR-CLIP	20371350
MIRT572360	hsa-miR-4632-3p	PAR-CLIP	20371350
MIRT572359	hsa-miR-6512-3p	PAR-CLIP	20371350
MIRT572358	hsa-miR-6720-5p	PAR-CLIP	20371350
MIRT2085377	hsa-miR-4708-5p	CLIP-seq

Show/Hide all (10)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001755	Process	Neural crest cell migration	IBA
GO:0005515	Function	Protein binding	IPI	25416956, 32296183
GO:0005874	Component	Microtubule	IBA
GO:0005874	Component	Microtubule	IDA	23209302
GO:0007155	Process	Cell adhesion	IEA
GO:0007165	Process	Signal transduction	IEA
GO:0032991	Component	Protein-containing complex	IDA	26780829
GO:0034446	Process	Substrate adhesion-dependent cell spreading	IBA
GO:0034446	Process	Substrate adhesion-dependent cell spreading	IDA	23209302
GO:0051020	Function	GTPase binding	IBA

MIM	HGNC	e!Ensembl
611491	22226	ENSG00000157927

Q96JH8

Protein name

Ras-associating and dilute domain-containing protein

Protein function

Downstream effector of Rap required for cell adhesion and migration of neural crest precursors during development.

PDB

1UM1 , 3EC8

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00788	RA	61 → 164	Ras association (RalGDS/AF-6) domain	Domain
PF01843	DIL	635 → 742	DIL domain	Family
PF00595	PDZ	976 → 1058	PDZ domain	Domain

Sequence

MFYGTHFIMSPPTKSKLKRQSQLLSSMLSRTLSYKYRDLDSTFSSLGASDDPAELSTQLS
APGVLKVFGDSVCTGTHYKSVLATGTSSARELVKEALERYALDPRQAGQYVLCDVVGQAG
DAGQRWQARCFRVFGDSEKPLLIQELWKPREGLSRRFELRKRSDVEELAAKEVDTITAGI
NAQARRLQRSRAKGTPTPALGDARSSPPPRLRRTVSETSLSPVNALPAAAQGPEEPGPDA
MRYSLYQSPHLLLLQGYSQQHDSLVYVLNRDRHTVGQRTPSSKPSISLSAPDILPLHCTI
RRQPLPDSGQAAGRLVLEPIPGAHISVNFSEVGHRTVVLHHGDLLSLGLYYLLLFKDPAQ
AQPLPARALARLRAVPQSCRLCGAALGARGAASPTQAALPRRQQLLLEFEPHLEDTLLQR
IMTLIEPGGDDHKLTPAFLLCLCIQHSATHFQPGTFGQLLLKIARLIRETVWEKTKELAE
KQAQLQEPISLASCAMADLVPDLQPILFWMSNSIELLYFIQQKCPLYMQSMEEQLDITGS
KESLFSCTLTASEEAMAVLEEVVLYAFQQCVYYVSKSLYICLPALLECPPFQTERRESWS
SAPELPEELRRVVSVYQAALDLLRQLQVHPEVASQMLAYLFFFSGTLLLNQLLDRGPSLS
CFHWPRGVQACARLQQLLEWMRSAGFGAAGEHFFQKLSCTLNLLATPRAQLIQMSWTALR
AAFPALSPAQLHRLLTHYQLASAMGPMSTWEPGAQDSPEAFRSEDVLESYENPPPIVLPS
DGFQVDLEANCLDDSIYQHLLYVRHFLWGLRSRASPGSPGRPGSGASQPVCPEGMHHVVL
DGHLEAPSCPLAPRDPGPAAREVAPERTLPLRGAPWAQAPPGRQPSRGGSQAGPPHTDSS
CLLTPPSTPLGPEPGDPDWPESGGPCGKALPERQRNGLSGLRGAAPEGDSAALAEESPPA
PSSRSSSTEDFCYVFTVELERGPSGLGMGLIDGMHTHLGAPGLYIQTLLPGSPAAADGRL
SLGDRILEVNGSSLLGLGYLRAVDLIRHGGKKMRFLVAKSDVETAKKIHFRTPPL

Sequence length

1075

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (8)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ALZHEIMER DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CENTRAL NERVOUS SYSTEM CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOBLASTOMA MULTIFORME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung cancer	Uncertain significance; Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (5)

Disease Name	Disease (Merged)	Source	PMID	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Malignant neoplasm of kidney	Kidney Cancer	BEFREE	31448237	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	31448237	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	31448237	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	31448237	★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal carcinoma	Renal Carcinoma	BEFREE	31448237	★★★★★ ★☆☆☆☆ Found in Text Mining only

RADIL (Rap associating with DIL domain)