RAD51AP1 (RAD51 associated protein 1)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases Related genes Diseases linked via similar genes

Gene

• Entrez ID: 10635
• Gene name: RAD51 associated protein 1
• Gene symbol: RAD51AP1
• Synonyms (NCBI Gene): PIR51
• Chromosome: 12
• Chromosome location: 12p13.32

miRNA Show/Hide all (98)

miRTarBase ID	miRNA	Experiments	Reference
MIRT022219	hsa-miR-124-3p	Microarray	18668037
MIRT042708	hsa-miR-346	CLASH	23622248
MIRT273163	hsa-miR-7844-5p	PAR-CLIP	23592263
MIRT273162	hsa-miR-548at-5p	PAR-CLIP	23592263
MIRT457353	hsa-miR-561-3p	PAR-CLIP	23592263
MIRT273159	hsa-miR-708-3p	PAR-CLIP	23592263
MIRT273157	hsa-miR-18a-5p	PAR-CLIP	23592263
MIRT273158	hsa-miR-18b-5p	PAR-CLIP	23592263
MIRT273161	hsa-miR-4735-3p	PAR-CLIP	23592263
MIRT337611	hsa-miR-4724-5p	PAR-CLIP	23592263
MIRT273163	hsa-miR-7844-5p	PAR-CLIP	23592263
MIRT273162	hsa-miR-548at-5p	PAR-CLIP	23592263
MIRT457353	hsa-miR-561-3p	PAR-CLIP	23592263
MIRT273159	hsa-miR-708-3p	PAR-CLIP	23592263
MIRT273157	hsa-miR-18a-5p	PAR-CLIP	23592263
MIRT273158	hsa-miR-18b-5p	PAR-CLIP	23592263
MIRT273161	hsa-miR-4735-3p	PAR-CLIP	23592263
MIRT337611	hsa-miR-4724-5p	PAR-CLIP	23592263
MIRT1287987	hsa-miR-1197	CLIP-seq
MIRT1287988	hsa-miR-1255a	CLIP-seq
MIRT1287989	hsa-miR-1255b	CLIP-seq
MIRT1287990	hsa-miR-203	CLIP-seq
MIRT1287991	hsa-miR-21	CLIP-seq
MIRT1287992	hsa-miR-2681	CLIP-seq
MIRT1287993	hsa-miR-3138	CLIP-seq
MIRT1287994	hsa-miR-3662	CLIP-seq
MIRT1287995	hsa-miR-3691-5p	CLIP-seq
MIRT1287996	hsa-miR-4424	CLIP-seq
MIRT1287997	hsa-miR-4481	CLIP-seq
MIRT1287998	hsa-miR-4491	CLIP-seq
MIRT1287999	hsa-miR-4657	CLIP-seq
MIRT1288000	hsa-miR-4682	CLIP-seq
MIRT1288001	hsa-miR-4720-3p	CLIP-seq
MIRT1288002	hsa-miR-4729	CLIP-seq
MIRT1288003	hsa-miR-4745-5p	CLIP-seq
MIRT1288004	hsa-miR-4758-5p	CLIP-seq
MIRT1288005	hsa-miR-4800-5p	CLIP-seq
MIRT1288006	hsa-miR-548a-3p	CLIP-seq
MIRT1288007	hsa-miR-548ae	CLIP-seq
MIRT1288008	hsa-miR-548aj	CLIP-seq
MIRT1288009	hsa-miR-548am	CLIP-seq
MIRT1288010	hsa-miR-548e	CLIP-seq
MIRT1288011	hsa-miR-548f	CLIP-seq
MIRT1288012	hsa-miR-548x	CLIP-seq
MIRT1288013	hsa-miR-549	CLIP-seq
MIRT1288014	hsa-miR-562	CLIP-seq
MIRT1288015	hsa-miR-590-5p	CLIP-seq
MIRT1288016	hsa-miR-873	CLIP-seq
MIRT1288017	hsa-miR-1264	CLIP-seq
MIRT1288018	hsa-miR-150	CLIP-seq
MIRT1287991	hsa-miR-21	CLIP-seq
MIRT1288019	hsa-miR-3163	CLIP-seq
MIRT1288020	hsa-miR-320a	CLIP-seq
MIRT1288021	hsa-miR-320b	CLIP-seq
MIRT1288022	hsa-miR-320c	CLIP-seq
MIRT1288023	hsa-miR-320d	CLIP-seq
MIRT1288024	hsa-miR-3616-5p	CLIP-seq
MIRT1288025	hsa-miR-3647-5p	CLIP-seq
MIRT1288026	hsa-miR-3671	CLIP-seq
MIRT1288027	hsa-miR-3919	CLIP-seq
MIRT1288028	hsa-miR-3925-5p	CLIP-seq
MIRT1288029	hsa-miR-3942-3p	CLIP-seq
MIRT1288030	hsa-miR-4429	CLIP-seq
MIRT1288031	hsa-miR-4635	CLIP-seq
MIRT1288032	hsa-miR-4679	CLIP-seq
MIRT1288033	hsa-miR-4691-5p	CLIP-seq
MIRT1288034	hsa-miR-4709-3p	CLIP-seq
MIRT1288035	hsa-miR-4713-5p	CLIP-seq
MIRT1288001	hsa-miR-4720-3p	CLIP-seq
MIRT1288036	hsa-miR-4797-5p	CLIP-seq
MIRT1288037	hsa-miR-4803	CLIP-seq
MIRT1288038	hsa-miR-486-5p	CLIP-seq
MIRT1288039	hsa-miR-532-3p	CLIP-seq
MIRT1288040	hsa-miR-543	CLIP-seq
MIRT1288013	hsa-miR-549	CLIP-seq
MIRT1288014	hsa-miR-562	CLIP-seq
MIRT1288041	hsa-miR-573	CLIP-seq
MIRT1288015	hsa-miR-590-5p	CLIP-seq
MIRT1287991	hsa-miR-21	CLIP-seq
MIRT2310741	hsa-miR-4477a	CLIP-seq
MIRT1288001	hsa-miR-4720-3p	CLIP-seq
MIRT1288006	hsa-miR-548a-3p	CLIP-seq
MIRT1288010	hsa-miR-548e	CLIP-seq
MIRT1288011	hsa-miR-548f	CLIP-seq
MIRT2310742	hsa-miR-548m	CLIP-seq
MIRT1288013	hsa-miR-549	CLIP-seq
MIRT2310743	hsa-miR-561	CLIP-seq
MIRT1288014	hsa-miR-562	CLIP-seq
MIRT2310744	hsa-miR-577	CLIP-seq
MIRT1288015	hsa-miR-590-5p	CLIP-seq
MIRT2457685	hsa-miR-124	CLIP-seq
MIRT2457686	hsa-miR-4305	CLIP-seq
MIRT2457687	hsa-miR-506	CLIP-seq
MIRT2457688	hsa-miR-548an	CLIP-seq
MIRT2457685	hsa-miR-124	CLIP-seq
MIRT2457686	hsa-miR-4305	CLIP-seq
MIRT2457687	hsa-miR-506	CLIP-seq
MIRT2457688	hsa-miR-548an	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
MEN1	Unknown	23648481

Gene ontology (GO) Show/Hide all (40)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000217	Function	DNA secondary structure binding	IDA	17996710
GO:0000724	Process	Double-strand break repair via homologous recombination	IBA
GO:0000724	Process	Double-strand break repair via homologous recombination	IMP	26323318
GO:0000724	Process	Double-strand break repair via homologous recombination	NAS	9396801
GO:0000781	Component	Chromosome, telomeric region	IEA
GO:0000785	Component	Chromatin	IDA	26323318
GO:0003677	Function	DNA binding	IDA	31253762
GO:0003677	Function	DNA binding	IEA
GO:0003690	Function	Double-stranded DNA binding	IBA
GO:0003690	Function	Double-stranded DNA binding	IDA	9396801, 17996711, 26323318
GO:0003690	Function	Double-stranded DNA binding	TAS	9396801
GO:0003697	Function	Single-stranded DNA binding	IBA
GO:0003697	Function	Single-stranded DNA binding	IDA	9396801, 17996711
GO:0003697	Function	Single-stranded DNA binding	TAS	9396801
GO:0003723	Function	RNA binding	IDA	9396801
GO:0003723	Function	RNA binding	IEA
GO:0003723	Function	RNA binding	TAS	9396801
GO:0005515	Function	Protein binding	IPI	9396801, 16990250, 17996710, 17996711, 20871616, 21307306, 21903585, 23754376, 25416956, 26323318, 27239033, 27463890, 32296183
GO:0005634	Component	Nucleus	IC	9396801
GO:0005634	Component	Nucleus	IDA	26323318
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	TAS	9396801
GO:0005654	Component	Nucleoplasm	TAS
GO:0005694	Component	Chromosome	IEA
GO:0005694	Component	Chromosome	ISS
GO:0006281	Process	DNA repair	IEA
GO:0006281	Process	DNA repair	NAS	9396801
GO:0006281	Process	DNA repair	TAS	9396801
GO:0006310	Process	DNA recombination	IEA
GO:0006974	Process	DNA damage response	IDA	17996710, 17996711
GO:0006974	Process	DNA damage response	IEA
GO:0010569	Process	Regulation of double-strand break repair via homologous recombination	IDA	23754376
GO:0010845	Process	Positive regulation of reciprocal meiotic recombination	IDA	17996711
GO:0032991	Component	Protein-containing complex	IMP	16990250
GO:0036297	Process	Interstrand cross-link repair	IBA
GO:0036297	Process	Interstrand cross-link repair	IMP	26323318
GO:0051321	Process	Meiotic cell cycle	IEA
GO:0062037	Function	D-loop DNA binding	IDA	17996711
GO:0071479	Process	Cellular response to ionizing radiation	IDA	23754376
GO:1905168	Process	Positive regulation of double-strand break repair via homologous recombination	IDA	17996710, 17996711

Other IDs

• MIM: 603070
• HGNC: 16956
• e!Ensembl: ENSG00000111247

Protein

• UniProt ID: Q96B01
• Protein name: RAD51-associated protein 1 (HsRAD51AP1) (RAD51-interacting protein)
• Protein function: Structure-specific DNA-binding protein involved in DNA repair by promoting RAD51-mediated homologous recombination (PubMed:17996710, PubMed:17996711, PubMed:20871616, PubMed:25288561, PubMed:26323318). Acts by stimulating D-Loop formation by RAD
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF15696	RAD51_interact	311 → 349	RAD51 interacting motif	Family

• Tissue specificity: TISSUE SPECIFICITY: Highly expressed in testis and thymus (PubMed:9396801). Lower levels in colon and small intestine (PubMed:9396801). Little or no expression in spleen, prostate, ovary and peripheral blood leukocytes (PubMed:9396801). {ECO:0000269|PubMe
• Sequence:

  MVRPVRHKKPVNYSQFDHSDSDDDFVSATVPLNKKSRTAPKELKQDKPKPNLNNLRKEEI
  PVQEKTPKKRLPEGTFSIPASAVPCTKMALDDKLYQRDLEVALALSVKELPTVTTNVQNS
  QDKSIEKHGSSKIETMNKSPHISNCSVASDYLDLDKITVEDDVGGVQGKRKAASKAAAQQ
  RKILLEGSDGDSANDTEPDFAPGEDSEDDSDFCESEDNDEDFSMRKSKVKEIKKKEVKVK
  SPVEKKEKKSKSKCNALVTSVDSAPAAVKSESQSLPKKVSLSSDTTRKPLEIRSPSAESK
  KPKWVPPAASGGSRSSSSPLVVVSVKSPNQSLRLGLSRLARVKPLHPNATST

• Sequence length: 352

Pathways

Reactome Pathway

HDR through Homologous Recombination (HRR)

Resolution of D-loop Structures through Synthesis-Dependent Strand Annealing (SDSA)

Resolution of D-loop Structures through Holliday Junction Intermediates

Homologous DNA Pairing and Strand Exchange

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations Show/Hide Unknown Diseases (7)
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Acute myeloid leukemia	Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervical cancer	Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Clear cell carcinoma of kidney	Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of esophagus	Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining Show/Hide Text Mining Associations (34)
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Alternating hemiplegia of childhood	Alternating hemiplegia of childhood	Pubtator	31400850	Associate	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	33172895, 34646403	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	35403252	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	14966907	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	33269607, 37461802, 39874008	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	29126163		★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	35403252	Associate	★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	LHGDN	18316552		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	35392038	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	35856434	Associate	★☆☆☆☆ Found in Text Mining only
Fanconi Anemia	Fanconi anemia	Pubtator	31253762	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	31532757		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	37283490, 39528802	Associate	★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	31532757		★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart disease	Pubtator	31400850	Associate	★☆☆☆☆ Found in Text Mining only
Intrahepatic Cholangiocarcinoma	Intrahepatic Cholangiocarcinoma	BEFREE	18316552		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	14966907		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver cirrhosis	Pubtator	33269607	Stimulate	★☆☆☆☆ Found in Text Mining only
Liver Neoplasms	Liver neoplasm	Pubtator	14966907	Associate	★☆☆☆☆ Found in Text Mining only
Lung Diseases	Lung disease	Pubtator	29126163	Associate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	29126163	Stimulate	★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	29126163		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	28963981, 29126163, 30068487, 31420354		★☆☆☆☆ Found in Text Mining only
Mantle cell lymphoma	Mantle Cell Lymphoma	BEFREE	16920159		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	28112719		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	31317661		★☆☆☆☆ Found in Text Mining only
Ovarian Diseases	Ovarian diseases	Pubtator	29126163	Associate	★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	29126163	Stimulate	★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	33314567	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	35403252	Associate	★☆☆☆☆ Found in Text Mining only
Small Lymphocytic Lymphoma	Lymphocytic Leukemia	BEFREE	16920159		★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	26810418	Associate	★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	31641220		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	31641220	Associate	★☆☆☆☆ Found in Text Mining only

Related Genes

Sort by: Blended Diseases Pathways Evidence source

XRCC3 4 shared pathwaysHDR through Homologous Recombination (HRR), Resolution of D-loop Structures through Synthesis-Dependent Strand Annealing (SDSA), Resolution of D-loop Structures through Holliday Junction Intermediates, Homologous DNA Pairing and Strand Exchange Related via 4 shared pathways including HDR through Homologous Recombination (HRR), Resolution of D-loop Structures through Synthesis-Dependent Strand Annealing (SDSA). XRCC2 4 shared pathwaysHDR through Homologous Recombination (HRR), Resolution of D-loop Structures through Synthesis-Dependent Strand Annealing (SDSA), Resolution of D-loop Structures through Holliday Junction Intermediates, Homologous DNA Pairing and Strand Exchange Related via 4 shared pathways including HDR through Homologous Recombination (HRR), Resolution of D-loop Structures through Synthesis-Dependent Strand Annealing (SDSA). PALB2 4 shared pathwaysHDR through Homologous Recombination (HRR), Resolution of D-loop Structures through Synthesis-Dependent Strand Annealing (SDSA), Resolution of D-loop Structures through Holliday Junction Intermediates, Homologous DNA Pairing and Strand Exchange Related via 4 shared pathways including HDR through Homologous Recombination (HRR), Resolution of D-loop Structures through Synthesis-Dependent Strand Annealing (SDSA). RAD51B 4 shared pathwaysHDR through Homologous Recombination (HRR), Resolution of D-loop Structures through Synthesis-Dependent Strand Annealing (SDSA), Resolution of D-loop Structures through Holliday Junction Intermediates, Homologous DNA Pairing and Strand Exchange Related via 4 shared pathways including HDR through Homologous Recombination (HRR), Resolution of D-loop Structures through Synthesis-Dependent Strand Annealing (SDSA). RAD51D 4 shared pathwaysHDR through Homologous Recombination (HRR), Resolution of D-loop Structures through Synthesis-Dependent Strand Annealing (SDSA), Resolution of D-loop Structures through Holliday Junction Intermediates, Homologous DNA Pairing and Strand Exchange Related via 4 shared pathways including HDR through Homologous Recombination (HRR), Resolution of D-loop Structures through Synthesis-Dependent Strand Annealing (SDSA).

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
XRCC3	0	[]	4	["HDR through Homologous Recombination (HRR)","Resolution of D-loop Structures through Synthesis-Dependent Strand Annealing (SDSA)","Resolution of D-loop Structures through Holliday Junction Intermediates","Homologous DNA Pairing and Strand Exchange"]	0	[]
XRCC2	0	[]	4	["HDR through Homologous Recombination (HRR)","Resolution of D-loop Structures through Synthesis-Dependent Strand Annealing (SDSA)","Resolution of D-loop Structures through Holliday Junction Intermediates","Homologous DNA Pairing and Strand Exchange"]	0	[]
PALB2	0	[]	4	["HDR through Homologous Recombination (HRR)","Resolution of D-loop Structures through Synthesis-Dependent Strand Annealing (SDSA)","Resolution of D-loop Structures through Holliday Junction Intermediates","Homologous DNA Pairing and Strand Exchange"]	0	[]
RAD51B	0	[]	4	["HDR through Homologous Recombination (HRR)","Resolution of D-loop Structures through Synthesis-Dependent Strand Annealing (SDSA)","Resolution of D-loop Structures through Holliday Junction Intermediates","Homologous DNA Pairing and Strand Exchange"]	0	[]
RAD51D	0	[]	4	["HDR through Homologous Recombination (HRR)","Resolution of D-loop Structures through Synthesis-Dependent Strand Annealing (SDSA)","Resolution of D-loop Structures through Holliday Junction Intermediates","Homologous DNA Pairing and Strand Exchange"]	0	[]

Diseases Linked via Similar Genes

Breast neoplasms Linked via 4 of 5 related genesXRCC3, XRCC2, PALB2, RAD51B Breast cancer Linked via 3 of 5 related genesXRCC3, PALB2, RAD51B Prostate cancer Linked via 3 of 5 related genesPALB2, RAD51B, RAD51D Insomnia Linked via 2 of 5 related genesXRCC3, RAD51B Fanconi anemia Linked via 2 of 5 related genesXRCC2, PALB2

Disease	Linked Via (Gene Count)	Linked Via (Gene Names)
Breast neoplasms	4	["XRCC3","XRCC2","PALB2","RAD51B"]
Breast cancer	3	["XRCC3","PALB2","RAD51B"]
Prostate cancer	3	["PALB2","RAD51B","RAD51D"]
Insomnia	2	["XRCC3","RAD51B"]
Fanconi anemia	2	["XRCC2","PALB2"]