Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	5876
Gene name	Rab geranylgeranyltransferase subunit beta
Gene symbol	RABGGTB
Synonyms (NCBI Gene)	GGTB
Chromosome	1
Chromosome location	1p31.1
Summary	This gene encodes the beta-subunit of the enzyme Rab geranylgeranyl-transferase (RabGGTase), which belongs to the protein prenyltransferase family. RabGGTase catalyzes the post-translational addition of geranylgeranyl groups to C-terminal cysteine residue

53 Show/Hide all (53)

miRTarBase ID	miRNA	Experiments	Reference
MIRT027619	hsa-miR-98-5p	Microarray	19088304
MIRT031743	hsa-miR-16-5p	Proteomics	18668040
MIRT049400	hsa-miR-92a-3p	CLASH	23622248
MIRT041493	hsa-miR-193b-3p	CLASH	23622248
MIRT036472	hsa-miR-1226-3p	CLASH	23622248
MIRT2310414	hsa-miR-132	CLIP-seq
MIRT2310415	hsa-miR-199a-3p	CLIP-seq
MIRT2310416	hsa-miR-199b-3p	CLIP-seq
MIRT2310417	hsa-miR-212	CLIP-seq
MIRT2310418	hsa-miR-300	CLIP-seq
MIRT2310419	hsa-miR-3129-5p	CLIP-seq
MIRT2310420	hsa-miR-338-5p	CLIP-seq
MIRT2310421	hsa-miR-3671	CLIP-seq
MIRT2310422	hsa-miR-381	CLIP-seq
MIRT2310423	hsa-miR-4666-3p	CLIP-seq
MIRT2310424	hsa-miR-4760-5p	CLIP-seq
MIRT2310425	hsa-miR-4803	CLIP-seq
MIRT2310426	hsa-miR-607	CLIP-seq
MIRT2310427	hsa-miR-935	CLIP-seq
MIRT2310420	hsa-miR-338-5p	CLIP-seq
MIRT2606823	hsa-miR-1183	CLIP-seq
MIRT2606824	hsa-miR-1245b-3p	CLIP-seq
MIRT2606825	hsa-miR-1275	CLIP-seq
MIRT2606826	hsa-miR-1297	CLIP-seq
MIRT2606827	hsa-miR-26a	CLIP-seq
MIRT2606828	hsa-miR-26b	CLIP-seq
MIRT2606829	hsa-miR-3133	CLIP-seq
MIRT2606830	hsa-miR-3148	CLIP-seq
MIRT2606831	hsa-miR-4465	CLIP-seq
MIRT2606832	hsa-miR-4511	CLIP-seq
MIRT2606833	hsa-miR-4525	CLIP-seq
MIRT2606834	hsa-miR-4665-5p	CLIP-seq
MIRT2606835	hsa-miR-4668-5p	CLIP-seq
MIRT2606836	hsa-miR-4700-3p	CLIP-seq
MIRT2606837	hsa-miR-4723-5p	CLIP-seq
MIRT2606838	hsa-miR-4731-3p	CLIP-seq
MIRT2606839	hsa-miR-4773	CLIP-seq
MIRT2606840	hsa-miR-4789-5p	CLIP-seq
MIRT2606841	hsa-miR-4801	CLIP-seq
MIRT2606842	hsa-miR-4802-3p	CLIP-seq
MIRT2606843	hsa-miR-488	CLIP-seq
MIRT2606844	hsa-miR-499-3p	CLIP-seq
MIRT2606845	hsa-miR-499a-3p	CLIP-seq
MIRT2606846	hsa-miR-548c-3p	CLIP-seq
MIRT2606847	hsa-miR-548m	CLIP-seq
MIRT2606848	hsa-miR-625	CLIP-seq
MIRT2606823	hsa-miR-1183	CLIP-seq
MIRT2606829	hsa-miR-3133	CLIP-seq
MIRT2606832	hsa-miR-4511	CLIP-seq
MIRT2606836	hsa-miR-4700-3p	CLIP-seq
MIRT2606838	hsa-miR-4731-3p	CLIP-seq
MIRT2606840	hsa-miR-4789-5p	CLIP-seq
MIRT2606841	hsa-miR-4801	CLIP-seq

22 Show/Hide all (22)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003824	Function	Catalytic activity	IEA
GO:0004659	Function	Prenyltransferase activity	IEA
GO:0004661	Function	Protein geranylgeranyltransferase activity	IEA
GO:0004663	Function	Rab geranylgeranyltransferase activity	IBA
GO:0004663	Function	Rab geranylgeranyltransferase activity	IEA
GO:0004663	Function	Rab geranylgeranyltransferase activity	ISS
GO:0005515	Function	Protein binding	IPI	12620389, 25416956, 28514442, 32296183, 33961781, 35271311
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	TAS
GO:0005968	Component	Rab-protein geranylgeranyltransferase complex	IBA
GO:0005968	Component	Rab-protein geranylgeranyltransferase complex	ISO
GO:0005968	Component	Rab-protein geranylgeranyltransferase complex	ISS
GO:0006888	Process	Endoplasmic reticulum to Golgi vesicle-mediated transport	IBA
GO:0007601	Process	Visual perception	TAS	8380507
GO:0008270	Function	Zinc ion binding	ISS
GO:0008318	Function	Protein prenyltransferase activity	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0018344	Process	Protein geranylgeranylation	ISS
GO:0031267	Function	Small GTPase binding	ISS
GO:0036211	Process	Protein modification process	NAS	8380507
GO:0046872	Function	Metal ion binding	IEA

MIM	HGNC	e!Ensembl
179080	9796	ENSG00000137955

P53611

Protein name

Geranylgeranyl transferase type-2 subunit beta (EC 2.5.1.60) (Geranylgeranyl transferase type II subunit beta) (GGTase-II-beta) (Rab geranyl-geranyltransferase subunit beta) (Rab GG transferase beta) (Rab GGTase beta) (Rab geranylgeranyltransferase subuni

Protein function

Catalyzes the transfer of a geranylgeranyl moiety from geranylgeranyl diphosphate to both cysteines of Rab proteins with the C-terminal sequence -XXCC, -XCXC and -CCXX, such as RAB1A, RAB3A, RAB5A and RAB7A.

PDB

6J6X , 6J74 , 6J7F , 6J7X , 6O60

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00432	Prenyltrans	162 → 205	Prenyltransferase and squalene oxidase repeat	Repeat
PF00432	Prenyltrans	258 → 302	Prenyltransferase and squalene oxidase repeat	Repeat
PF00432	Prenyltrans	114 → 157	Prenyltransferase and squalene oxidase repeat	Repeat
PF00432	Prenyltrans	210 → 253	Prenyltransferase and squalene oxidase repeat	Repeat
PF00432	Prenyltrans	66 → 109	Prenyltransferase and squalene oxidase repeat	Repeat

Sequence

MGTPQKDVIIKSDAPDTLLLEKHADYIASYGSKKDDYEYCMSEYLRMSGIYWGLTVMDLM
GQLHRMNREEILAFIKSCQHECGGISASIGHDPHLLYTLSAVQILTLYDSINVIDVNKVV
EYVKGLQKEDGSFAGDIWGEIDTRFSFCAVATLALLGKLDAINVEKAIEFVLSCMNFDGG
FGCRPGSESHAGQIYCCTGFLAITSQLHQVNSDLLGWWLCERQLPSGGLNGRPEKLPDVC
YSWWVLASLKIIGRLHWIDREKLRNFILACQDEETGGFADRPGDMVDPFHTLFGIAGLSL
LGEEQIKPVNPVFCMPEEVLQRVNVQPELVS

Sequence length

331

Interactions

View interactions

Reactome Pathway
TP53 regulates transcription of several additional cell death genes whose specific roles in p53-dependent apoptosis remain uncertain
RAB geranylgeranylation

RABGGTB (Rab geranylgeranyltransferase subunit beta)

Bookmark This Gene