Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	150786
Gene name	RAB6D, member RAS oncogene family
Gene symbol	RAB6D
Synonyms (NCBI Gene)	RAB6CLWTH3DI
Chromosome	2
Chromosome location	2q21.1

18 Show/Hide all (18)

GO ID	Ontology	Definition	Evidence
GO:0000166	Function	Nucleotide binding	IEA
GO:0003924	Function	GTPase activity	IBA
GO:0003924	Function	GTPase activity	IEA
GO:0005525	Function	GTP binding	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005794	Component	Golgi apparatus	IBA
GO:0005794	Component	Golgi apparatus	IDA
GO:0005829	Component	Cytosol	IEA
GO:0006886	Process	Intracellular protein transport	IBA
GO:0006890	Process	Retrograde vesicle-mediated transport, Golgi to endoplasmic reticulum	IBA
GO:0006891	Process	Intra-Golgi vesicle-mediated transport	IBA
GO:0012505	Component	Endomembrane system	IBA
GO:0016787	Function	Hydrolase activity	IEA
GO:0036064	Component	Ciliary basal body	IDA
GO:0036064	Component	Ciliary basal body	IEA
GO:0042147	Process	Retrograde transport, endosome to Golgi	IBA
GO:0046872	Function	Metal ion binding	IEA
GO:1903292	Process	Protein localization to Golgi membrane	IBA

MIM	HGNC	e!Ensembl
HGNC	N/A	HGNC

Q53S08

Protein name

Ras-related protein Rab-6D (EC 3.6.5.2) (Rab6-like protein WTH3DI)

Protein function

The small GTPases Rab are key regulators of intracellular membrane trafficking, from the formation of transport vesicles to their fusion with membranes. Rabs cycle between an inactive GDP-bound form and an active GTP-bound form that is able to r

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00071	Ras	15 → 175	Ras family	Domain

Sequence

MSAGGDFGNPLRKFKLVFLGEQSVAKTSLITRFRYDSFDNTYQAIIGIDFLSKTMYLEDG
TIGLRLWDTAGQERLRSLIPRYIRDSAAAVVVYDITNVNSFQQTTKWIDDVRTEGGSDVI
ITLVGNKTDLADKRQVSIEEGERKAKGLNVTFIETRAKAGYNVKQLFRRVAAALPGMEST
QDGSREDMSDIKLEKPQEQTVSEGGCSCYSPMSSSTLPQKPPYSFIDCSVNIGLNLFPSL
ITFCNSSLLPVSWR

Sequence length

254

Interactions

View interactions

Related Genes Genes most often co-reported with RAB6D across shared curated disease and pathway associations. 0 Download as csv Download as pdf
No strongly related genes found yet for RAB6D.

Diseases Linked via Similar Genes Diseases curated for genes most similar to RAB6D (see Related Genes above), that are NOT already directly curated for RAB6D itself -- a lead worth checking, not a confirmed association. 0 Download as csv Download as pdf
No additional diseases found yet through genes similar to RAB6D.

RAB6D (RAB6D, member RAS oncogene family)

Bookmark This Gene