RAB41 (RAB41, member RAS oncogene family)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 347517
Gene name RAB41, member RAS oncogene family
Gene symbol RAB41
Synonyms (NCBI Gene)
-
Chromosome X
Chromosome location Xq13.1
Summary This gene encodes a small GTP-binding protein that belongs to the largest family within the Ras superfamily. These proteins function as regulators of membrane trafficking. They cycle between inactive GDP-bound and activated GTP-bound states, which is cont
miRNA miRNA information provided by mirtarbase database.
15 Show/Hide all (15)
Download as csvDownload as pdf
miRTarBase ID miRNA Experiments Reference
MIRT534804 hsa-miR-6507-3p PAR-CLIP 22012620
MIRT534803 hsa-miR-5588-3p PAR-CLIP 22012620
MIRT534802 hsa-miR-764 PAR-CLIP 22012620
MIRT534801 hsa-miR-7977 PAR-CLIP 22012620
MIRT534800 hsa-miR-4659a-5p PAR-CLIP 22012620
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
21 Show/Hide all (21)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0000139 Component Golgi membrane TAS
GO:0000166 Function Nucleotide binding IEA
GO:0003924 Function GTPase activity IBA
GO:0003924 Function GTPase activity IEA
GO:0003925 Function G protein activity IMP 23936529
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
HGNC N/A HGNC
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q5JT25
Protein name Ras-related protein Rab-41 (EC 3.6.5.2)
Protein function The small GTPases Rab are key regulators of intracellular membrane trafficking, from the formation of transport vesicles to their fusion with membranes. Rabs cycle between an inactive GDP-bound form and an active GTP-bound form that is able to r
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00071 Ras 33 → 194 Ras family Domain
Tissue specificity TISSUE SPECIFICITY: Widely expressed in brain, testis, lung, heart, ovary, colon, kidney, uterus and spleen but not in liver. {ECO:0000269|PubMed:15018353}.
Sequence 
MSAFGHDEAWMEAGGFGLEAAERTEYQSLCKSKLLFLGEQSVGKTSIISRFMYNSFGCAC
QATVGIDFLSKTMYLEDQIVQLQLWDTAGQERFHSLIPSYIRDSTIAVVVYDITNINSFK
ETDKWVEHVRAERGDDVVIMLLGNKIDLDNKRQVTAEQGEEKSRNLNVMFIETSAKTGYN
VKKLFRRVASALLSTRTSPPPKEGTVEIELESFEESGNRSYC
Sequence length 222
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Download as csvDownload as pdf
Reactome Pathway
Intra-Golgi traffic
RAB geranylgeranylation
Sort by:
RAB30 2 shared pathwaysIntra-Golgi traffic, RAB geranylgeranylation Related via 2 shared pathways including Intra-Golgi traffic, RAB geranylgeranylation. RAB36 2 shared pathwaysIntra-Golgi traffic, RAB geranylgeranylation Related via 2 shared pathways including Intra-Golgi traffic, RAB geranylgeranylation. RAB39A 2 shared pathwaysIntra-Golgi traffic, RAB geranylgeranylation Related via 2 shared pathways including Intra-Golgi traffic, RAB geranylgeranylation. RAB33B 2 shared pathwaysIntra-Golgi traffic, RAB geranylgeranylation Related via 2 shared pathways including Intra-Golgi traffic, RAB geranylgeranylation.
Uterine fibroid Linked via 1 of 4 related genesRAB39A Desbuquois syndrome Linked via 1 of 4 related genesRAB33B Smith-mccort dysplasia Linked via 1 of 4 related genesRAB33B