RAB40A (RAB40A, member RAS oncogene family)

Download as csv Download as pdf

Log in to save this analysis

Save This Analysis

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Pathways Related genes Diseases linked via similar genes

Gene

• Entrez ID: 142684
• Gene name: RAB40A, member RAS oncogene family
• Gene symbol: RAB40A
• Synonyms (NCBI Gene): RAR2, RAR2A
• Chromosome: X
• Chromosome location: Xq22.2
• Summary: This gene encodes a member of the Rab40 subfamily of Rab small GTP-binding proteins that contains a C-terminal suppressors of cytokine signaling box. [provided by RefSeq, Apr 2010]

miRNA Show/Hide all (25)

miRTarBase ID	miRNA	Experiments	Reference
MIRT017532	hsa-miR-335-5p	Microarray	18185580
MIRT717351	hsa-miR-766-3p	HITS-CLIP	19536157
MIRT717350	hsa-miR-3925-3p	HITS-CLIP	19536157
MIRT717349	hsa-miR-4251	HITS-CLIP	19536157
MIRT717348	hsa-miR-4329	HITS-CLIP	19536157
MIRT717347	hsa-miR-6761-5p	HITS-CLIP	19536157
MIRT717346	hsa-miR-1253	HITS-CLIP	19536157
MIRT717345	hsa-miR-6770-5p	HITS-CLIP	19536157
MIRT717344	hsa-miR-4660	HITS-CLIP	19536157
MIRT717343	hsa-miR-515-5p	HITS-CLIP	19536157
MIRT717342	hsa-miR-519e-5p	HITS-CLIP	19536157
MIRT717341	hsa-miR-1301-3p	HITS-CLIP	19536157
MIRT717340	hsa-miR-5047	HITS-CLIP	19536157
MIRT717351	hsa-miR-766-3p	HITS-CLIP	19536157
MIRT717350	hsa-miR-3925-3p	HITS-CLIP	19536157
MIRT717349	hsa-miR-4251	HITS-CLIP	19536157
MIRT717348	hsa-miR-4329	HITS-CLIP	19536157
MIRT717347	hsa-miR-6761-5p	HITS-CLIP	19536157
MIRT717346	hsa-miR-1253	HITS-CLIP	19536157
MIRT717345	hsa-miR-6770-5p	HITS-CLIP	19536157
MIRT717344	hsa-miR-4660	HITS-CLIP	19536157
MIRT717343	hsa-miR-515-5p	HITS-CLIP	19536157
MIRT717342	hsa-miR-519e-5p	HITS-CLIP	19536157
MIRT717341	hsa-miR-1301-3p	HITS-CLIP	19536157
MIRT717340	hsa-miR-5047	HITS-CLIP	19536157

Gene ontology (GO) Show/Hide all (21)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0003924	Function	GTPase activity	IBA
GO:0003924	Function	GTPase activity	IEA
GO:0005525	Function	GTP binding	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0005768	Component	Endosome	IBA
GO:0005794	Component	Golgi apparatus	IDA	34469730
GO:0005811	Component	Lipid droplet	IDA	34469730
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IEA
GO:0006887	Process	Exocytosis	IBA
GO:0008021	Component	Synaptic vesicle	IBA
GO:0016020	Component	Membrane	IEA
GO:0016567	Process	Protein ubiquitination	IEA
GO:0016787	Function	Hydrolase activity	IEA
GO:0031466	Component	Cul5-RING ubiquitin ligase complex	IMP	26598620
GO:0035556	Process	Intracellular signal transduction	IEA
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	IMP	26598620
GO:0046872	Function	Metal ion binding	IEA
GO:0120184	Process	Negative regulation of focal adhesion disassembly	IMP	26598620
GO:1990756	Function	Ubiquitin-like ligase-substrate adaptor activity	IMP	26598620

Other IDs

• MIM: 301065
• HGNC: 18283
• e!Ensembl: ENSG00000172476

Protein

• UniProt ID: Q8WXH6
• Protein name: Ras-related protein Rab-40A (EC 3.6.5.2) (SOCS box-containing protein RAR2A) (Protein Rar-2)
• Protein function: RAB40A small GTPase acts as substrate-recognition component of the ECS(RAB40A) E3 ubiquitin ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins (PubMed:26598620). The Rab40 subfamily belongs
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00071	Ras	16 → 176	Ras family	Domain
  PF07525	SOCS_box	189 → 225	SOCS box	Domain

• Sequence:

  MSAPGSPDQAYDFLLKFLLVGDRDVGKSEILESLQDGAAESPYSHLGGIDYKTTTILLDG
  QRVKLKLWDTSGQGRFCTIFRSYSRGAQGVILVYDIANRWSFEGMDRWIKKIEEHAPGVP
  KILVGNRLHLAFKRQVPREQAQAYAERLGVTFFEVSPLCNFNIIESFTELARIVLLRHRM
  NWLGRPSKVLSLQDLCCRTIVSCTPVHLVDKLPLPSTLRSHLKSFSMAKGLNARMMRGLS
  YSLTTSSTHKSSLCKVEIVCPPQSPPKNCTRNSCKIS

• Sequence length: 277

Pathways

Reactome Pathway:

RAB geranylgeranylation

Related Genes

No strongly related genes found yet for RAB40A.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to RAB40A.