RAB26 (RAB26, member RAS oncogene family)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Pathways Related genes Diseases linked via similar genes

Gene

• Entrez ID: 25837
• Gene name: RAB26, member RAS oncogene family
• Gene symbol: RAB26
• Synonyms (NCBI Gene): V46133
• Chromosome: 16
• Chromosome location: 16p13.3
• Summary: Members of the RAB protein family, including RAB26, are important regulators of vesicular fusion and trafficking. The RAB family of small G proteins regulates intercellular vesicle trafficking, including exocytosis, endocytosis, and recycling (summary by

miRNA Show/Hide all (16)

miRTarBase ID	miRNA	Experiments	Reference
MIRT017292	hsa-miR-335-5p	Microarray	18185580
MIRT039448	hsa-miR-421	CLASH	23622248
MIRT1282950	hsa-miR-184	CLIP-seq
MIRT1282951	hsa-miR-3199	CLIP-seq
MIRT1282952	hsa-miR-3614-3p	CLIP-seq
MIRT1282953	hsa-miR-3654	CLIP-seq
MIRT1282954	hsa-miR-4515	CLIP-seq
MIRT1282955	hsa-miR-4804-5p	CLIP-seq
MIRT2083846	hsa-miR-3192	CLIP-seq
MIRT2083847	hsa-miR-3689a-3p	CLIP-seq
MIRT2083848	hsa-miR-3689c	CLIP-seq
MIRT2083849	hsa-miR-4728-5p	CLIP-seq
MIRT2083850	hsa-miR-4731-5p	CLIP-seq
MIRT2083851	hsa-miR-541	CLIP-seq
MIRT2083852	hsa-miR-654-5p	CLIP-seq
MIRT2083853	hsa-miR-765	CLIP-seq

Gene ontology (GO) Show/Hide all (33)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000139	Component	Golgi membrane	IDA	23105096
GO:0000139	Component	Golgi membrane	IEA
GO:0000166	Function	Nucleotide binding	IEA
GO:0003924	Function	GTPase activity	IBA
GO:0003924	Function	GTPase activity	IEA
GO:0005515	Function	Protein binding	IPI	23105096, 32296183
GO:0005525	Function	GTP binding	IBA
GO:0005525	Function	GTP binding	IEA
GO:0005525	Function	GTP binding	IMP	23105096
GO:0005525	Function	GTP binding	ISS
GO:0005768	Component	Endosome	IBA
GO:0005794	Component	Golgi apparatus	IBA
GO:0005794	Component	Golgi apparatus	IEA
GO:0005886	Component	Plasma membrane	ISS
GO:0015031	Process	Protein transport	IEA
GO:0016020	Component	Membrane	IEA
GO:0016787	Function	Hydrolase activity	IEA
GO:0017157	Process	Regulation of exocytosis	IBA
GO:0017157	Process	Regulation of exocytosis	ISS
GO:0019002	Function	GMP binding	IMP	23105096
GO:0030658	Component	Transport vesicle membrane	IEA
GO:0030667	Component	Secretory granule membrane	IEA
GO:0030667	Component	Secretory granule membrane	ISS
GO:0030672	Component	Synaptic vesicle membrane	IDA	25643395
GO:0030672	Component	Synaptic vesicle membrane	IMP	25643395
GO:0031410	Component	Cytoplasmic vesicle	IEA
GO:0035272	Process	Exocrine system development	IMP	20038531
GO:0035272	Process	Exocrine system development	ISS
GO:0043001	Process	Golgi to plasma membrane protein transport	IMP	23105096
GO:0045055	Process	Regulated exocytosis	IMP	20038531
GO:0046872	Function	Metal ion binding	IEA
GO:0140251	Process	Regulation protein catabolic process at presynapse	IDA	29084947
GO:0140251	Process	Regulation protein catabolic process at presynapse	IMP	29084947

Other IDs

• MIM: 605455
• HGNC: 14259
• e!Ensembl: ENSG00000167964

Protein

• UniProt ID: Q9ULW5
• Protein name: Ras-related protein Rab-26 (EC 3.6.5.2)
• Protein function: The small GTPases Rab are key regulators of intracellular membrane trafficking, from the formation of transport vesicles to their fusion with membranes. Rabs cycle between an inactive GDP-bound form and an active GTP-bound form that is able to r
• PDB: 2G6B
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00071	Ras	65 → 227	Ras family	Domain

• Tissue specificity: TISSUE SPECIFICITY: Predominantly expressed in brain.
• Sequence:

  MSRKKTPKSKGASTPAASTLPTANGARPARSGTALSGPDAPPNGPLQPGRPSLGGGVDFY
  DVAFKVMLVGDSGVGKTCLLVRFKDGAFLAGTFISTVGIDFRNKVLDVDGVKVKLQMWDT
  AGQERFRSVTHAYYRDAHALLLLYDVTNKASFDNIQAWLTEIHEYAQHDVALMLLGNKVD
  SAHERVVKREDGEKLAKEYGLPFMETSAKTGLNVDLAFTAIAKELKQRSMKAPSEPRFRL
  HDYVKREGRGASCCRP

• Sequence length: 256

Pathways

Reactome Pathway:

RAB geranylgeranylation

Related Genes

No strongly related genes found yet for RAB26.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to RAB26.