RAB24 (RAB24, member RAS oncogene family)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Pathways Related genes Diseases linked via similar genes

Gene

• Entrez ID: 53917
• Gene name: RAB24, member RAS oncogene family
• Gene symbol: RAB24
• Synonyms (NCBI Gene): -
• Chromosome: 5
• Chromosome location: 5q35.3
• Summary: RAB24 is a small GTPase of the Rab subfamily of Ras-related proteins that regulate intracellular protein trafficking (Olkkonen et al., 1993 [PubMed 8126105]).[supplied by OMIM, Aug 2009]

miRNA Show/Hide all (53)

miRTarBase ID	miRNA	Experiments	Reference
MIRT1282931	hsa-miR-4514	CLIP-seq
MIRT1282932	hsa-miR-4692	CLIP-seq
MIRT1282933	hsa-miR-940	CLIP-seq
MIRT1282934	hsa-miR-129-3p	CLIP-seq
MIRT1282935	hsa-miR-938	CLIP-seq
MIRT1282934	hsa-miR-129-3p	CLIP-seq
MIRT1282935	hsa-miR-938	CLIP-seq
MIRT2083824	hsa-miR-302a	CLIP-seq
MIRT2083825	hsa-miR-302b	CLIP-seq
MIRT2083826	hsa-miR-302c	CLIP-seq
MIRT2083827	hsa-miR-302d	CLIP-seq
MIRT2083828	hsa-miR-302e	CLIP-seq
MIRT2083829	hsa-miR-372	CLIP-seq
MIRT2083830	hsa-miR-373	CLIP-seq
MIRT2083831	hsa-miR-520a-3p	CLIP-seq
MIRT2083832	hsa-miR-520b	CLIP-seq
MIRT2083833	hsa-miR-520c-3p	CLIP-seq
MIRT2083834	hsa-miR-520d-3p	CLIP-seq
MIRT2083835	hsa-miR-520e	CLIP-seq
MIRT1282934	hsa-miR-129-3p	CLIP-seq
MIRT1282935	hsa-miR-938	CLIP-seq
MIRT2309021	hsa-miR-214	CLIP-seq
MIRT2309022	hsa-miR-3153	CLIP-seq
MIRT2309023	hsa-miR-3619-5p	CLIP-seq
MIRT2309024	hsa-miR-4492	CLIP-seq
MIRT2309025	hsa-miR-4498	CLIP-seq
MIRT2309026	hsa-miR-4699-3p	CLIP-seq
MIRT2309027	hsa-miR-761	CLIP-seq
MIRT2309028	hsa-miR-762	CLIP-seq
MIRT2605890	hsa-miR-1224-5p	CLIP-seq
MIRT1282934	hsa-miR-129-3p	CLIP-seq
MIRT2605891	hsa-miR-1324	CLIP-seq
MIRT2605892	hsa-miR-28-5p	CLIP-seq
MIRT2605893	hsa-miR-3139	CLIP-seq
MIRT2605894	hsa-miR-3661	CLIP-seq
MIRT2605895	hsa-miR-4487	CLIP-seq
MIRT2605896	hsa-miR-4751	CLIP-seq
MIRT2605897	hsa-miR-492	CLIP-seq
MIRT2605898	hsa-miR-631	CLIP-seq
MIRT2605899	hsa-miR-708	CLIP-seq
MIRT1282935	hsa-miR-938	CLIP-seq
MIRT2605890	hsa-miR-1224-5p	CLIP-seq
MIRT1282934	hsa-miR-129-3p	CLIP-seq
MIRT2605891	hsa-miR-1324	CLIP-seq
MIRT2605892	hsa-miR-28-5p	CLIP-seq
MIRT2605893	hsa-miR-3139	CLIP-seq
MIRT2605894	hsa-miR-3661	CLIP-seq
MIRT2605895	hsa-miR-4487	CLIP-seq
MIRT2605896	hsa-miR-4751	CLIP-seq
MIRT2605897	hsa-miR-492	CLIP-seq
MIRT2605898	hsa-miR-631	CLIP-seq
MIRT2605899	hsa-miR-708	CLIP-seq
MIRT1282935	hsa-miR-938	CLIP-seq

Gene ontology (GO) Show/Hide all (38)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0000421	Component	Autophagosome membrane	IEA
GO:0000421	Component	Autophagosome membrane	ISS
GO:0001556	Process	Oocyte maturation	IEA
GO:0001556	Process	Oocyte maturation	ISS
GO:0003924	Function	GTPase activity	IBA
GO:0003924	Function	GTPase activity	IEA
GO:0003925	Function	G protein activity	IEA
GO:0003925	Function	G protein activity	ISS
GO:0005515	Function	Protein binding	IPI	16034420, 20562859, 32296183, 33961781, 35271311
GO:0005525	Function	GTP binding	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0005739	Component	Mitochondrion	HTP	34800366
GO:0005768	Component	Endosome	IBA
GO:0005776	Component	Autophagosome	IBA
GO:0005776	Component	Autophagosome	IEA
GO:0005819	Component	Spindle	IEA
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	IEA
GO:0005856	Component	Cytoskeleton	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0006886	Process	Intracellular protein transport	IBA
GO:0006914	Process	Autophagy	IEA
GO:0006914	Process	Autophagy	ISS
GO:0008608	Process	Attachment of spindle microtubules to kinetochore	IEA
GO:0008608	Process	Attachment of spindle microtubules to kinetochore	ISS
GO:0012505	Component	Endomembrane system	IBA
GO:0015031	Process	Protein transport	IEA
GO:0016020	Component	Membrane	IEA
GO:0016787	Function	Hydrolase activity	IEA
GO:0030139	Component	Endocytic vesicle	IBA
GO:0030667	Component	Secretory granule membrane	TAS
GO:0031410	Component	Cytoplasmic vesicle	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0048471	Component	Perinuclear region of cytoplasm	IEA
GO:0048471	Component	Perinuclear region of cytoplasm	ISS
GO:0140013	Process	Meiotic nuclear division	IEA
GO:0140013	Process	Meiotic nuclear division	ISS

Other IDs

• MIM: 612415
• HGNC: 9765
• e!Ensembl: ENSG00000169228

Protein

• UniProt ID: Q969Q5
• Protein name: Ras-related protein Rab-24 (EC 3.6.5.2)
• Protein function: The small GTPases Rab are key regulators of intracellular membrane trafficking, from the formation of transport vesicles to their fusion with membranes. Rabs cycle between an inactive GDP-bound form and an active GTP-bound form that is able to r
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00071	Ras	9 → 174	Ras family	Domain

• Sequence:

  MSGQRVDVKVVMLGKEYVGKTSLVERYVHDRFLVGPYQNTIGAAFVAKVMSVGDRTVTLG
  IWDTAGSERYEAMSRIYYRGAKAAIVCYDLTDSSSFERAKFWVKELRSLEEGCQIYLCGT
  KSDLLEEDRRRRRVDFHDVQDYADNIKAQLFETSSKTGQSVDELFQKVAEDYVSVAAFQV
  MTEDKGVDLGQKPNPYFYSCCHH

• Sequence length: 203

Pathways

Reactome Pathway

Neutrophil degranulation

RAB geranylgeranylation

Related Genes

No strongly related genes found yet for RAB24.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to RAB24.