RAB20 (RAB20, member RAS oncogene family)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases Related genes Diseases linked via similar genes

Gene

• Entrez ID: 55647
• Gene name: RAB20, member RAS oncogene family
• Gene symbol: RAB20
• Synonyms (NCBI Gene): -
• Chromosome: 13
• Chromosome location: 13q34

miRNA Show/Hide all (36)

miRTarBase ID	miRNA	Experiments	Reference
MIRT1282366	hsa-miR-1299	CLIP-seq
MIRT1282367	hsa-miR-3148	CLIP-seq
MIRT1282368	hsa-miR-3166	CLIP-seq
MIRT1282369	hsa-miR-3665	CLIP-seq
MIRT1282370	hsa-miR-4771	CLIP-seq
MIRT1282371	hsa-miR-4782-5p	CLIP-seq
MIRT1282372	hsa-miR-502-5p	CLIP-seq
MIRT1282373	hsa-miR-516b	CLIP-seq
MIRT1282374	hsa-miR-616	CLIP-seq
MIRT1282375	hsa-miR-657	CLIP-seq
MIRT1282376	hsa-miR-764	CLIP-seq
MIRT1282377	hsa-miR-875-3p	CLIP-seq
MIRT2083588	hsa-miR-29a	CLIP-seq
MIRT2083589	hsa-miR-29b	CLIP-seq
MIRT2083590	hsa-miR-29c	CLIP-seq
MIRT2083591	hsa-miR-3663-3p	CLIP-seq
MIRT2083592	hsa-miR-4733-3p	CLIP-seq
MIRT2083593	hsa-miR-4781-5p	CLIP-seq
MIRT2083594	hsa-miR-486-3p	CLIP-seq
MIRT2083595	hsa-miR-744	CLIP-seq
MIRT2308802	hsa-miR-1224-3p	CLIP-seq
MIRT2308803	hsa-miR-1260	CLIP-seq
MIRT2308804	hsa-miR-1260b	CLIP-seq
MIRT2308805	hsa-miR-1280	CLIP-seq
MIRT2308806	hsa-miR-188-3p	CLIP-seq
MIRT2308807	hsa-miR-3149	CLIP-seq
MIRT2308808	hsa-miR-3156-3p	CLIP-seq
MIRT2308809	hsa-miR-3159	CLIP-seq
MIRT2308810	hsa-miR-3646	CLIP-seq
MIRT2308811	hsa-miR-4286	CLIP-seq
MIRT2308812	hsa-miR-568	CLIP-seq
MIRT2605790	hsa-miR-3150b-3p	CLIP-seq
MIRT2605791	hsa-miR-4499	CLIP-seq
MIRT2605792	hsa-miR-4689	CLIP-seq
MIRT2605793	hsa-miR-4784	CLIP-seq
MIRT2605794	hsa-miR-4786-5p	CLIP-seq

Gene ontology (GO) Show/Hide all (23)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0003924	Function	GTPase activity	IBA
GO:0003924	Function	GTPase activity	IEA
GO:0005525	Function	GTP binding	IEA
GO:0005769	Component	Early endosome	IBA
GO:0005794	Component	Golgi apparatus	IDA
GO:0005794	Component	Golgi apparatus	IEA
GO:0005886	Component	Plasma membrane	IBA
GO:0006886	Process	Intracellular protein transport	IBA
GO:0006897	Process	Endocytosis	IBA
GO:0012505	Component	Endomembrane system	IBA
GO:0015031	Process	Protein transport	IEA
GO:0016020	Component	Membrane	IEA
GO:0016787	Function	Hydrolase activity	IEA
GO:0030139	Component	Endocytic vesicle	IBA
GO:0030670	Component	Phagocytic vesicle membrane	IEA
GO:0031410	Component	Cytoplasmic vesicle	IEA
GO:0045335	Component	Phagocytic vesicle	IDA	21255211
GO:0045335	Component	Phagocytic vesicle	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0071346	Process	Cellular response to type II interferon	IEA
GO:0090383	Process	Phagosome acidification	IMP	21255211
GO:0090385	Process	Phagosome-lysosome fusion	IMP	21255211

Other IDs

• MIM: HGNC
• HGNC: N/A
• e!Ensembl: HGNC

Protein

• UniProt ID: Q9NX57
• Protein name: Ras-related protein Rab-20 (EC 3.6.5.2)
• Protein function: The small GTPases Rab are key regulators of intracellular membrane trafficking, from the formation of transport vesicles to their fusion with membranes. Rabs cycle between an inactive GDP-bound form and an active GTP-bound form that is able to r
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00071	Ras	7 → 202	Ras family	Domain

• Tissue specificity: TISSUE SPECIFICITY: Low or absent expression in normal pancreas and stronger expression in 15 of 18 exocrine pancreatic adenocarcinomas (at protein level). {ECO:0000269|PubMed:16613320}.
• Sequence:

  MRKPDSKIVLLGDMNVGKTSLLQRYMERRFPDTVSTVGGAFYLKQWRSYNISIWDTAGRE
  QFHGLGSMYCRGAAAIILTYDVNHRQSLVELEDRFLGLTDTASKDCLFAIVGNKVDLTEE
  GALAGQEKEECSPNMDAGDRVSPRAPKQVQLEDAVALYKKILKYKMLDEQDVPAAEQMCF
  ETSAKTGYNVDLLFETLFDLVVPMILQQRAERPSHTVDISSHKPPKRTRSGCCA

• Sequence length: 234

Pathways

Reactome Pathway:

RAB geranylgeranylation

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
BILIARY ATRESIA	—	GWAS catalog	37572794	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPOTHYROIDISM	—	GWAS catalog	30595370, 39024449, 39067062, 41238958	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OLIGODENDROGLIOMA	—	GWAS catalog	36810956	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining Show/Hide Text Mining Associations (12)
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adenocarcinoma	Adenocarcinoma	BEFREE	16613320		★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	21102417		★☆☆☆☆ Found in Text Mining only
Aneuploidy	Aneuploidy	Pubtator	21102417	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	16613320, 21102417		★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	34401050	Inhibit	★☆☆☆☆ Found in Text Mining only
Carotid Stenosis	Carotid artery stenosis	Pubtator	31589004	Associate	★☆☆☆☆ Found in Text Mining only
Hypothyroidism	Hypothyroidism	GWASCAT_DG	30595370		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Leukemia, Myelocytic, Acute	Leukemia	GWASCAT_DG	27903959		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	23018034		★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndromes	Myelodysplastic syndrome	Pubtator	15147372	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	16613320		★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	22724020	Associate	★☆☆☆☆ Found in Text Mining only

Related Genes

No strongly related genes found yet for RAB20.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to RAB20.