RAB1C (RAB1C, member RAS oncogene family (pseudogene))

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 441400
Gene name RAB1C, member RAS oncogene family (pseudogene)
Gene symbol RAB1C
Synonyms (NCBI Gene)
-
Chromosome 9
Chromosome location 9p13.2
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
16 Show/Hide all (16)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0000045 Process Autophagosome assembly IBA
GO:0000166 Function Nucleotide binding IEA
GO:0003924 Function GTPase activity IBA
GO:0003924 Function GTPase activity IEA
GO:0003925 Function G protein activity IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
HGNC 23683 N/A
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q92928
Protein name Putative Ras-related protein Rab-1C (hRab1c) (EC 3.6.5.2)
Protein function Protein transport. Probably involved in vesicular traffic (By similarity).
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00071 Ras 10 → 171 Ras family Domain
Sequence 
MNPGYDCLFKLLLIGDSGVGKSCLLLRFADDPYTESYISTIGVDFKIQTIELDGKTIKLQ
IWDTAGQERFWTITSSYYRGAHGFLVVYDVTDQESYANVKQWLQEIDRHASENVNKLLVG
NKSDLTTKKVVDNTTAKEFADSLGIPFLETSAKNATNVEQAFMTMAAEIKKQMGPGAASG
GERPNLKIDSTPVKPAGGGCC
Sequence length 201
Interactions View interactions

No strongly related genes found yet for RAB1C.

No additional diseases found yet through genes similar to RAB1C.