QTRT2 (queuine tRNA-ribosyltransferase accessory subunit 2)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Pathways Related genes Diseases linked via similar genes

Gene

• Entrez ID: 79691
• Gene name: Queuine tRNA-ribosyltransferase accessory subunit 2
• Gene symbol: QTRT2
• Synonyms (NCBI Gene): QTRTD1
• Chromosome: 3
• Chromosome location: 3q13.31
• Summary: This gene encodes a subunit of tRNA-guanine transglycosylase. tRNA-guanine transglycosylase is a heterodimeric enzyme complex that plays a critical role in tRNA modification by synthesizing the 7-deazaguanosine queuosine, which is found in tRNAs that code

miRNA Show/Hide all (28)

miRTarBase ID	miRNA	Experiments	Reference
MIRT542308	hsa-miR-6501-3p	HITS-CLIP	23706177
MIRT542307	hsa-miR-340-3p	HITS-CLIP	23706177
MIRT542306	hsa-miR-6827-3p	HITS-CLIP	23706177
MIRT542305	hsa-miR-939-3p	HITS-CLIP	23706177
MIRT542299	hsa-miR-4486	HITS-CLIP	23706177
MIRT542298	hsa-miR-4708-3p	HITS-CLIP	23706177
MIRT542297	hsa-miR-661	HITS-CLIP	23706177
MIRT542296	hsa-miR-1273a	HITS-CLIP	23706177
MIRT542295	hsa-miR-4649-5p	HITS-CLIP	23706177
MIRT542294	hsa-miR-6729-5p	HITS-CLIP	23706177
MIRT542309	hsa-miR-3613-3p	PAR-CLIP	21572407
MIRT542308	hsa-miR-6501-3p	PAR-CLIP	21572407
MIRT542307	hsa-miR-340-3p	PAR-CLIP	21572407
MIRT542306	hsa-miR-6827-3p	PAR-CLIP	21572407
MIRT542305	hsa-miR-939-3p	PAR-CLIP	21572407
MIRT542304	hsa-miR-371b-5p	PAR-CLIP	21572407
MIRT542303	hsa-miR-373-5p	PAR-CLIP	21572407
MIRT542302	hsa-miR-616-5p	PAR-CLIP	21572407
MIRT542301	hsa-miR-371a-5p	PAR-CLIP	21572407
MIRT542300	hsa-miR-372-5p	PAR-CLIP	21572407
MIRT542299	hsa-miR-4486	PAR-CLIP	21572407
MIRT542298	hsa-miR-4708-3p	PAR-CLIP	21572407
MIRT542297	hsa-miR-661	PAR-CLIP	21572407
MIRT542296	hsa-miR-1273a	PAR-CLIP	21572407
MIRT542295	hsa-miR-4649-5p	PAR-CLIP	21572407
MIRT542294	hsa-miR-6729-5p	PAR-CLIP	21572407
MIRT447430	hsa-miR-5582-3p	PAR-CLIP	22100165
MIRT447430	hsa-miR-5582-3p	PAR-CLIP	22100165

Gene ontology (GO) Show/Hide all (23)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000049	Function	TRNA binding	IDA	34241577
GO:0002099	Process	TRNA wobble guanine modification	IDA	20354154, 34241577
GO:0005515	Function	Protein binding	IPI	20354154
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	ISS
GO:0005739	Component	Mitochondrion	HTP	34800366
GO:0005739	Component	Mitochondrion	IEA
GO:0005739	Component	Mitochondrion	ISS
GO:0005741	Component	Mitochondrial outer membrane	IEA
GO:0005741	Component	Mitochondrial outer membrane	NAS	19414587
GO:0005741	Component	Mitochondrial outer membrane	TAS
GO:0006400	Process	TRNA modification	IDA	16424344, 37992713
GO:0006400	Process	TRNA modification	IEA
GO:0008033	Process	TRNA processing	IEA
GO:0008479	Function	TRNA-guanosine(34) queuine transglycosylase activity	IEA
GO:0016020	Component	Membrane	IEA
GO:0032473	Component	Cytoplasmic side of mitochondrial outer membrane	IEA
GO:0032991	Component	Protein-containing complex	IEA
GO:0042803	Function	Protein homodimerization activity	IDA	20354154
GO:0046872	Function	Metal ion binding	IEA
GO:0046982	Function	Protein heterodimerization activity	IDA	20354154
GO:0120507	Component	TRNA-guanine transglycosylase complex	IPI	20354154
GO:1990234	Component	Transferase complex	IPI	20354154

Other IDs

• MIM: HGNC
• HGNC: N/A
• e!Ensembl: HGNC

Protein

• UniProt ID: Q9H974
• Protein name: Queuine tRNA-ribosyltransferase accessory subunit 2 (Queuine tRNA-ribosyltransferase domain-containing protein 1)
• Protein function: Non-catalytic subunit of the queuine tRNA-ribosyltransferase (TGT) that catalyzes the base-exchange of a guanine (G) residue with queuine (Q) at position 34 (anticodon wobble position) in tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Ty
• PDB: 7NQ4 , 8OMR
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF01702	TGT	10 → 415	Queuine tRNA-ribosyltransferase	Family

• Sequence:

  MKLSLTKVVNGCRLGKIKNLGKTGDHTMDIPGCLLYTKTGSAPHLTHHTLHNIHGVPAMA
  QLTLSSLAEHHEVLTEYKEGVGKFIGMPESLLYCSLHDPVSPCPAGYVTNKSVSVWSVAG
  RVEMTVSKFMAIQKALQPDWFQCLSDGEVSCKEATSIKRVRKSVDRSLLFLDNCLRLQEE
  SEVLQKSVIIGVIEGGDVMEERLRSARETAKRPVGGFLLDGFQGNPTTLEARLRLLSSVT
  AELPEDKPRLISGVSRPDEVLECIERGVDLFESFFPYQVTERGCALTFSFDYQPNPEETL
  LQQNGTQEEIKCMDQIKKIETTGCNQEITSFEINLKEKKYQEDFNPLVRGCSCYCCKNHT
  RAYIHHLLVTNELLAGVLLMMHNFEHYFGFFHYIREALKSDKLAQLKELIHRQAS

• Sequence length: 415

Pathways

Reactome Pathway:

tRNA modification in the nucleus and cytosol

Related Genes

No strongly related genes found yet for QTRT2.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to QTRT2.