QTGAL (queuosine-tRNA galactosyltransferase)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 146712
Gene name Queuosine-tRNA galactosyltransferase
Gene symbol QTGAL
Synonyms (NCBI Gene)
3-Gn-T8B3GNT8B3GNTL1BGnT-8beta-1beta3Gn-T8beta3GnTL1
Chromosome 17
Chromosome location 17q25.3
miRNA miRNA information provided by mirtarbase database.
5
Download as csvDownload as pdf
miRTarBase ID miRNA Experiments Reference
MIRT813455 hsa-miR-3545-3p CLIP-seq
MIRT813456 hsa-miR-4279 CLIP-seq
MIRT813457 hsa-miR-4449 CLIP-seq
MIRT813455 hsa-miR-3545-3p CLIP-seq
MIRT813456 hsa-miR-4279 CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
10 Show/Hide all (10)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0005737 Component Cytoplasm IDA 37992713
GO:0005737 Component Cytoplasm IEA
GO:0006400 Process TRNA modification IDA 37992713
GO:0006400 Process TRNA modification IEA
GO:0006417 Process Regulation of translation IDA 37992713
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
615337 21727 ENSG00000175711
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q67FW5
Protein name Queuosine-tRNA galactosyltransferase (QTGAL) (EC 2.4.1.-) (Beta-1,3-N-acetylglucosaminyltransferase 8) (BGnT-8) (Beta-1,3-Gn-T8) (Beta3Gn-T8) (UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase-like protein 1) (BGnT-like protein 1) (Beta1,3-N-ace
Protein function Glycosyltransferase that specifically catalyzes galactosylation of cytoplasmic tRNA(Tyr) modified with queuosine at position 34 (queuosine(34)) (PubMed:37992713). Galactosylates the cyclopentene hydroxyl group of queuosine(34) in tRNA(Tyr) to fo
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00535 Glycos_transf_2 21 → 193 Glycosyl transferase family 2 Family
Tissue specificity TISSUE SPECIFICITY: Widely expressed. Highly expressed in adult pancreas. Expressed at moderate level in kidney, spleen, thymus, prostate, testis and ovary. Weakly expressed in small intestine, colon, peripheral blood leukocyte and liver. {ECO:0000269|Pub
Sequence 
MSGAGVGGASEESQAMQAHVSIILPVHNAEPWLDECLRSVLQQDFEGTMELSVFNDASKD
KSGAIIEKWRVKLEDSGVHVIIGGHDSPSPRGVGYAKNQAVAQSSGSYLCFLDSDDVMMP
QRVRLQHEAAVQHPSSIIGCRVRRDPPNSTERYTRWINQLTPEQLLTQVFTSNGPTVIMP
TWFCSRAWFSHVGPFNEGGQGVPEDLLFFYEHLRKGGGVIRVDQSLLLYRHHPQAATHCV
LETTIWTHRVRFLEEQALPRWAAFTIWNAGKQGRRLYRSLTAGSQRKVVAFCDVDENKIR
KGFYCHEDSQERPKPRIPILHFRAARPPFVICVKLDLTGGAFEDNLRSLHLQEGQDFLHF
S
Sequence length 361
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Download as csvDownload as pdf
Reactome Pathway
O-linked glycosylation of mucins

No strongly related genes found yet for QTGAL.

No additional diseases found yet through genes similar to QTGAL.