PYY3 (peptide YY 3 (pseudogene))

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 644059
Gene name Peptide YY 3 (pseudogene)
Gene symbol PYY3
Synonyms (NCBI Gene)
PYY-III
Chromosome X
Chromosome location Xp11.22
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
7 Show/Hide all (7)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0005179 Function Hormone activity IEA
GO:0005184 Function Neuropeptide hormone activity IBA
GO:0005576 Component Extracellular region IEA
GO:0005615 Component Extracellular space IBA
GO:0007218 Process Neuropeptide signaling pathway IBA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
HGNC 31855 N/A
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q5JQD4
Protein name Putative peptide YY-3 (Putative peptide YY3) (PYY-III)
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00159 Hormone_3 30 → 64 Pancreatic hormone peptide Family
Sequence 
MVSVCRPWPAVAIALLALLVCLGALVDTCPIKPEAPGEDESLEELSHYYASLCHYLNVVT
RQWWEGADMW
Sequence length 70
Interactions View interactions

No strongly related genes found yet for PYY3.

No additional diseases found yet through genes similar to PYY3.