PYDC5 (pyrin domain containing 5) | Gene Details, Disease Associations & Pathways | GeDiPNet

GeDiPNet

Log in to save this analysis

Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	107181291
Gene name	Pyrin domain containing 5
Gene symbol	PYDC5
Synonyms (NCBI Gene)	POP3
Chromosome	1
Chromosome location	1q23.1

8 Show/Hide all (8)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	24531343
GO:0006954	Process	Inflammatory response	IEA
GO:0031333	Process	Negative regulation of protein-containing complex assembly	IDA	24531343
GO:0035458	Process	Cellular response to interferon-beta	IDA	24531343
GO:0045088	Process	Regulation of innate immune response	IEA
GO:0071345	Process	Cellular response to cytokine stimulus	IEA
GO:0098586	Process	Cellular response to virus	IDA	24531343
GO:0140972	Process	Negative regulation of AIM2 inflammasome complex assembly	IDA	24531343

MIM	HGNC	e!Ensembl
HGNC	N/A	HGNC

Protein Protein information from UniProt database. Download as csv Download as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.	W6CW81
Protein name	Pyrin domain-containing protein 5 (Pyrin domain-only protein 3)
Protein function	Functions as an inhibitor of DNA virus-induced activation of AIM2-like receptors (ALR) inflammasome through interaction with AIM2.
Family and domains
Tissue specificity	TISSUE SPECIFICITY: Expressed in monocytic cell lines and primary macrophages but not in B or T cells. {ECO:0000269\|PubMed:24531343}.
Sequence	MESKYKEILLLTSLDNITDEELDRFKCFLPDEFNIATGKLHTLNSTSSQLDLKRWHGVCS EEDRIFQKLNYMLVAKCLREEQETGICGSPSSARSVSQSRLGLSFHGISGNAC
Sequence length	113
Interactions	View interactions

KEGG Pathway
NOD-like receptor signaling pathway