PYDC2 (pyrin domain containing 2)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene Gene ontology Other IDs Protein Pathways Related genes Diseases linked via similar genes

Gene

• Entrez ID: 152138
• Gene name: Pyrin domain containing 2
• Gene symbol: PYDC2
• Synonyms (NCBI Gene): POP2, cPOP2
• Chromosome: 3
• Chromosome location: 3q28

Gene ontology (GO) Show/Hide all (21)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002376	Process	Immune system process	IEA
GO:0005515	Function	Protein binding	IPI	17178784
GO:0005634	Component	Nucleus	IDA	17178784, 17339483
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005730	Component	Nucleolus	IDA
GO:0005737	Component	Cytoplasm	IDA	17178784, 17339483
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	IEA
GO:0006954	Process	Inflammatory response	IEA
GO:0009968	Process	Negative regulation of signal transduction	IEA
GO:0010804	Process	Negative regulation of tumor necrosis factor-mediated signaling pathway	IMP	17339483, 24871464
GO:0032088	Process	Negative regulation of NF-kappaB transcription factor activity	IMP	17339483, 24871464
GO:0032651	Process	Regulation of interleukin-1 beta production	IEA
GO:0032691	Process	Negative regulation of interleukin-1 beta production	IMP	17178784, 24871464
GO:0045087	Process	Innate immune response	IEA
GO:0050728	Process	Negative regulation of inflammatory response	IMP	17178784, 24871464
GO:1900226	Process	Negative regulation of NLRP3 inflammasome complex assembly	IMP	17339483, 24871464
GO:1901223	Process	Negative regulation of non-canonical NF-kappaB signal transduction	IEA
GO:1901223	Process	Negative regulation of non-canonical NF-kappaB signal transduction	IMP	17339483

Other IDs

• MIM: 615701
• HGNC: 33512
• e!Ensembl: ENSG00000253548

Protein

• UniProt ID: Q56P42
• Protein name: Pyrin domain-containing protein 2 (Pyrin-only protein 2) (cellular POP2) (cPOP2)
• Protein function: May play a role in innate immunity by disrupting the interaction between PYCARD and NLRP3, thereby regulating the NLRP3 inflammasome (PubMed:17178784, PubMed:17339483). May also inhibit NF-kappa-B signaling distally by affecting the nuclear accu
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF02758	PYRIN	10 → 86	PAAD/DAPIN/Pyrin domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Predominantly expressed in peripheral blood. Weakly expressed in testis. {ECO:0000269|PubMed:17339483}.
• Sequence:

  MASSAELDFNLQALLEQLSQDELSKFKSLIRTISLGKELQTVPQTEVDKANGKQLVEIFT
  SHSCSYWAGMAAIQVFEKMNQTHLSGRADEHCVMPPP

• Sequence length: 97

Pathways

KEGG Pathway:

NOD-like receptor signaling pathway

Related Genes

No strongly related genes found yet for PYDC2.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to PYDC2.