PYDC1 (pyrin domain containing 1)

Download as csv Download as pdf

Log in to save this analysis

Save This Analysis

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Pathways Diseases linked via similar genes

Gene

• Entrez ID: 260434
• Gene name: Pyrin domain containing 1
• Gene symbol: PYDC1
• Synonyms (NCBI Gene): ASC2, POP1, PYC1, cPOP1
• Chromosome: 16
• Chromosome location: 16p11.2

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT2605206	hsa-miR-1281	CLIP-seq
MIRT2605207	hsa-miR-4267	CLIP-seq
MIRT2605208	hsa-miR-759	CLIP-seq
MIRT2605209	hsa-miR-766	CLIP-seq

Gene ontology (GO) Show/Hide all (24)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002376	Process	Immune system process	IEA
GO:0005515	Function	Protein binding	IPI	12656673
GO:0005634	Component	Nucleus	IDA	12656673
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA	12656673
GO:0008385	Component	IkappaB kinase complex	IDA	12656673
GO:0008385	Component	IkappaB kinase complex	IEA
GO:0009968	Process	Negative regulation of signal transduction	IEA
GO:0010803	Process	Regulation of tumor necrosis factor-mediated signaling pathway	IEA
GO:0010804	Process	Negative regulation of tumor necrosis factor-mediated signaling pathway	IDA	12656673
GO:0010804	Process	Negative regulation of tumor necrosis factor-mediated signaling pathway	IMP	24871464
GO:0030291	Function	Protein serine/threonine kinase inhibitor activity	IDA	12656673
GO:0032088	Process	Negative regulation of NF-kappaB transcription factor activity	IMP	24871464
GO:0032691	Process	Negative regulation of interleukin-1 beta production	IMP	24871464
GO:0032731	Process	Positive regulation of interleukin-1 beta production	IEA
GO:0032731	Process	Positive regulation of interleukin-1 beta production	IGI	12656673
GO:0043124	Process	Negative regulation of canonical NF-kappaB signal transduction	IDA	12656673
GO:0043124	Process	Negative regulation of canonical NF-kappaB signal transduction	IEA
GO:0045087	Process	Innate immune response	IDA	12656673
GO:0098542	Process	Defense response to other organism	IEA
GO:0120283	Function	Protein serine/threonine kinase binding	IPI	12656673
GO:1900226	Process	Negative regulation of NLRP3 inflammasome complex assembly	IMP	24871464
GO:2000660	Process	Negative regulation of interleukin-1-mediated signaling pathway	IDA	12656673

Other IDs

• MIM: 615700
• HGNC: 30261
• e!Ensembl: ENSG00000169900

Protein

• UniProt ID: Q8WXC3
• Protein name: Pyrin domain-containing protein 1 (PAAD-only protein 1) (Pyrin-only protein 1) (cellular POP1) (cPOP1)
• Protein function: Associates with PYCARD/ASC and modulates its ability to collaborate with MEFV/pyrin and NLRP3/cryopyrin in NF-kappa-B and pro-caspase-1 activation. Suppresses kinase activity of NF-kappa-B inhibitor kinase (IKK) complex, expression of NF-kappa-B
• PDB: 2HM2 , 4QOB
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF02758	PYRIN	7 → 83	PAAD/DAPIN/Pyrin domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Predominantly expressed in monocytes, macrophages and granulocytes. {ECO:0000269|PubMed:12656673}.
• Sequence:

  MGTKREAILKVLENLTPEELKKFKMKLGTVPLREGFERIPRGALGQLDIVDLTDKLVASY
  YEDYAAELVVAVLRDMRMLEEAARLQRAA

• Sequence length: 89

Pathways

KEGG Pathway:

NOD-like receptor signaling pathway

Related Genes

No strongly related genes found yet for PYDC1.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to PYDC1.