PTTG3P (pituitary tumor-transforming 3, pseudogene)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 26255
Gene name Pituitary tumor-transforming 3, pseudogene
Gene symbol PTTG3P
Synonyms (NCBI Gene)
PTTG1P3PTTG3rcPTTG1
Chromosome 8
Chromosome location 8q13.1
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
6 Show/Hide all (6)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0005634 Component Nucleus IBA
GO:0005634 Component Nucleus IEA
GO:0005737 Component Cytoplasm IEA
GO:0017124 Function SH3 domain binding IEA
GO:0045143 Process Homologous chromosome segregation IBA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
HGNC N/A HGNC
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9NZH4
Protein name Putative pituitary tumor-transforming gene 3 protein (hPTTG3) (Securin-3) (rcPTTG1)
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF04856 Securin 1 → 187 Securin sister-chromatid separation inhibitor Family
Tissue specificity TISSUE SPECIFICITY: Expressed in ovarian tumor and tumor cell lines (SK-OV-3 and PA1). {ECO:0000269|PubMed:10806349}.
Sequence 
MATLIYVDKENEEPGILVATKDGLKLGSGPSIKALDGRSQVSISCFGKTFDAPTSLPKAT
RKALGTVNRATEKSVKTNGPLKQKQPSFSAKKMTEKTVKAKNSVPASDDGYPEIEKLFPF
NPLGFESFDLPEEHQIAHLPLSEVPLMILDEERELEKLFQLGPPSPLKMPSPPWKSNLLQ
SPLSILLTLDVELPPVCSDIDI
Sequence length 202
Interactions View interactions

No strongly related genes found yet for PTTG3P.

No additional diseases found yet through genes similar to PTTG3P.