PTRH1 (peptidyl-tRNA hydrolase 1 homolog)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Related genes Diseases linked via similar genes

Gene

• Entrez ID: 138428
• Gene name: Peptidyl-tRNA hydrolase 1 homolog
• Gene symbol: PTRH1
• Synonyms (NCBI Gene): C9orf115, PTH1
• Chromosome: 9
• Chromosome location: 9q34.11

miRNA Show/Hide all (29)

miRTarBase ID	miRNA	Experiments	Reference
MIRT005177	hsa-miR-30a-5p	pSILAC	18668040
MIRT005177	hsa-miR-30a-5p	Proteomics;Other	18668040
MIRT031393	hsa-miR-16-5p	Proteomics	18668040
MIRT1276689	hsa-miR-128	CLIP-seq
MIRT1276690	hsa-miR-27a	CLIP-seq
MIRT1276691	hsa-miR-27b	CLIP-seq
MIRT1276692	hsa-miR-4286	CLIP-seq
MIRT1276693	hsa-miR-4704-3p	CLIP-seq
MIRT2307412	hsa-miR-132	CLIP-seq
MIRT2307413	hsa-miR-212	CLIP-seq
MIRT2307414	hsa-miR-3125	CLIP-seq
MIRT2307415	hsa-miR-3150b-3p	CLIP-seq
MIRT2307416	hsa-miR-3916	CLIP-seq
MIRT2307417	hsa-miR-4514	CLIP-seq
MIRT2307418	hsa-miR-4692	CLIP-seq
MIRT2307419	hsa-miR-4784	CLIP-seq
MIRT2307420	hsa-miR-518d-5p	CLIP-seq
MIRT2307421	hsa-miR-519b-5p	CLIP-seq
MIRT2307422	hsa-miR-519c-5p	CLIP-seq
MIRT2307423	hsa-miR-520c-5p	CLIP-seq
MIRT2307424	hsa-miR-526a	CLIP-seq
MIRT2307425	hsa-miR-877	CLIP-seq
MIRT2393265	hsa-miR-34a	CLIP-seq
MIRT2393266	hsa-miR-34c-5p	CLIP-seq
MIRT2393267	hsa-miR-3652	CLIP-seq
MIRT2393268	hsa-miR-4430	CLIP-seq
MIRT2393269	hsa-miR-449a	CLIP-seq
MIRT2393270	hsa-miR-449b	CLIP-seq
MIRT2393271	hsa-miR-4505	CLIP-seq

Gene ontology (GO) Show/Hide all (10)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000049	Function	TRNA binding	IEA
GO:0003723	Function	RNA binding	HDA	22658674
GO:0003723	Function	RNA binding	IEA
GO:0004045	Function	Peptidyl-tRNA hydrolase activity	IBA
GO:0004045	Function	Peptidyl-tRNA hydrolase activity	IDA	30244831
GO:0004045	Function	Peptidyl-tRNA hydrolase activity	IEA
GO:0005515	Function	Protein binding	IPI	25416956, 32296183
GO:0005739	Component	Mitochondrion	HTP	34800366
GO:0016787	Function	Hydrolase activity	IEA
GO:0072344	Process	Rescue of stalled ribosome	IDA	30244831

Other IDs

• MIM: 621047
• HGNC: 27039
• e!Ensembl: ENSG00000187024

Protein

• UniProt ID: Q86Y79
• Protein name: Peptidyl-tRNA hydrolase (PTH) (EC 3.1.1.29)
• Protein function: Peptidyl-tRNA hydrolase that cleaves nascent chains-tRNAs that are not stably fixed in the P-site of 60S ribosome-nascent chain complexes (PubMed:30244831). Acts downstream of the ribosome-associated quality control (RQC) pathway to release non-
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF01195	Pept_tRNA_hydro	32 → 210	Peptidyl-tRNA hydrolase	Domain

• Sequence:

  MRPGGFLGAGQRLSRAMSRCVLEPRPPGKRWMVAGLGNPGLPGTRHSVGMAVLGQLARRL
  GVAESWTRDRHCAADLALAPLGDAQLVLLRPRRLMNANGRSVARAAELFGLTAEEVYLVH
  DELDKPLGRLALKLGGSARGHNGVRSCISCLNSNAMPRLRVGIGRPAHPEAVQAHVLGCF
  SPAEQELLPLLLDRATDLILDHIRERSQGPSLGP

• Sequence length: 214

Related Genes

No strongly related genes found yet for PTRH1.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to PTRH1.