PTPRJ (protein tyrosine phosphatase receptor type J)

Gene

• Entrez ID: 5795
• Gene name: Protein tyrosine phosphatase receptor type J
• Gene symbol: PTPRJ
• Synonyms (NCBI Gene): CD148, DEP1, HPTP eta, HPTPeta, R-PTP-ETA, R-PTP-J, SCC1, THC10
• Chromosome: 11
• Chromosome location: 11p11.2
• Summary: The protein encoded by this gene is a member of the protein tyrosine phosphatase (PTP) family. PTPs are known to be signaling molecules that regulate a variety of cellular processes, including cell growth, differentiation, mitotic cycle, and oncogenic tra

SNPs

SNP ID	Visualize variation	Clinical significance	Consequence
rs1566734	A>C	Pathogenic	Missense variant, coding sequence variant, non coding transcript variant
rs121434507	C>T	Pathogenic	Coding sequence variant, non coding transcript variant, missense variant

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT001514	hsa-miR-155-5p	pSILAC	18668040
MIRT006477	hsa-miR-328-3p	qRT-PCR, Western blot	22564856
MIRT006477	hsa-miR-328-3p	qRT-PCR, Western blot	22564856
MIRT006477	hsa-miR-328-3p	qRT-PCR, Western blot	22564856
MIRT006477	hsa-miR-328-3p	qRT-PCR, Western blot	22564856
MIRT006477	hsa-miR-328-3p	qRT-PCR, Western blot	22564856
MIRT006477	hsa-miR-328-3p	qRT-PCR, Western blot	22564856
MIRT017530	hsa-miR-335-5p	Microarray	18185580
MIRT001514	hsa-miR-155-5p	Proteomics;Other	18668040
MIRT022460	hsa-miR-124-3p	Microarray	18668037
MIRT029278	hsa-miR-26b-5p	Microarray	19088304
MIRT031605	hsa-miR-16-5p	Proteomics	18668040
MIRT049863	hsa-miR-31-5p	CLASH	23622248
MIRT469933	hsa-miR-6768-5p	HITS-CLIP	21572407
MIRT469932	hsa-miR-5011-5p	HITS-CLIP	21572407
MIRT469930	hsa-miR-936	HITS-CLIP	21572407
MIRT469927	hsa-miR-376a-2-5p	HITS-CLIP	21572407
MIRT469925	hsa-miR-4672	HITS-CLIP	21572407
MIRT469924	hsa-miR-376a-5p	HITS-CLIP	21572407
MIRT534914	hsa-miR-4789-5p	HITS-CLIP	21572407
MIRT555122	hsa-miR-190a-3p	HITS-CLIP	21572407
MIRT469922	hsa-miR-1277-5p	HITS-CLIP	21572407
MIRT469930	hsa-miR-936	HITS-CLIP	23313552
MIRT469929	hsa-miR-190a-5p	HITS-CLIP	23313552
MIRT469928	hsa-miR-190b	HITS-CLIP	23313552
MIRT469927	hsa-miR-376a-2-5p	HITS-CLIP	23313552
MIRT469924	hsa-miR-376a-5p	HITS-CLIP	23313552
MIRT534914	hsa-miR-4789-5p	HITS-CLIP	23313552
MIRT555122	hsa-miR-190a-3p	HITS-CLIP	23313552
MIRT469922	hsa-miR-1277-5p	HITS-CLIP	23313552
MIRT654623	hsa-miR-505-3p	HITS-CLIP	23824327
MIRT654622	hsa-miR-5007-5p	HITS-CLIP	23824327
MIRT654621	hsa-miR-1303	HITS-CLIP	23824327
MIRT654620	hsa-miR-3149	HITS-CLIP	23824327
MIRT130394	hsa-miR-548c-3p	HITS-CLIP	23824327
MIRT622555	hsa-miR-627-3p	HITS-CLIP	23824327
MIRT622554	hsa-miR-6516-3p	HITS-CLIP	23824327
MIRT130394	hsa-miR-548c-3p	HITS-CLIP	23824327
MIRT622555	hsa-miR-627-3p	HITS-CLIP	23824327
MIRT622554	hsa-miR-6516-3p	HITS-CLIP	23824327
MIRT555125	hsa-miR-4280	PAR-CLIP	21572407
MIRT469932	hsa-miR-5011-5p	PAR-CLIP	21572407
MIRT555124	hsa-miR-27b-5p	PAR-CLIP	21572407
MIRT555123	hsa-miR-142-3p	PAR-CLIP	21572407
MIRT555122	hsa-miR-190a-3p	PAR-CLIP	21572407
MIRT555121	hsa-miR-3591-5p	PAR-CLIP	21572407
MIRT469922	hsa-miR-1277-5p	PAR-CLIP	21572407
MIRT469933	hsa-miR-6768-5p	PAR-CLIP	22012620
MIRT469932	hsa-miR-5011-5p	PAR-CLIP	22012620
MIRT469931	hsa-miR-511-3p	PAR-CLIP	22012620
MIRT469930	hsa-miR-936	PAR-CLIP	22012620
MIRT469929	hsa-miR-190a-5p	PAR-CLIP	22012620
MIRT469928	hsa-miR-190b	PAR-CLIP	22012620
MIRT469927	hsa-miR-376a-2-5p	PAR-CLIP	22012620
MIRT469926	hsa-miR-597-5p	PAR-CLIP	22012620
MIRT469925	hsa-miR-4672	PAR-CLIP	22012620
MIRT469924	hsa-miR-376a-5p	PAR-CLIP	22012620
MIRT534914	hsa-miR-4789-5p	PAR-CLIP	22012620
MIRT469923	hsa-miR-592	PAR-CLIP	22012620
MIRT469922	hsa-miR-1277-5p	PAR-CLIP	22012620
MIRT469933	hsa-miR-6768-5p	PAR-CLIP	23592263
MIRT469932	hsa-miR-5011-5p	PAR-CLIP	23592263
MIRT469931	hsa-miR-511-3p	PAR-CLIP	23592263
MIRT469930	hsa-miR-936	PAR-CLIP	23592263
MIRT469929	hsa-miR-190a-5p	PAR-CLIP	23592263
MIRT469928	hsa-miR-190b	PAR-CLIP	23592263
MIRT469927	hsa-miR-376a-2-5p	PAR-CLIP	23592263
MIRT469926	hsa-miR-597-5p	PAR-CLIP	23592263
MIRT469925	hsa-miR-4672	PAR-CLIP	23592263
MIRT469924	hsa-miR-376a-5p	PAR-CLIP	23592263
MIRT469923	hsa-miR-592	PAR-CLIP	23592263
MIRT469922	hsa-miR-1277-5p	PAR-CLIP	23592263
MIRT130344	hsa-miR-205-5p	HITS-CLIP	22473208
MIRT130380	hsa-miR-15a-5p	HITS-CLIP	22473208
MIRT130382	hsa-miR-15b-5p	HITS-CLIP	22473208
MIRT031605	hsa-miR-16-5p	HITS-CLIP	22473208
MIRT130383	hsa-miR-195-5p	HITS-CLIP	22473208
MIRT130344	hsa-miR-205-5p	HITS-CLIP	22473208
MIRT130343	hsa-miR-92a-3p	HITS-CLIP	22473208
MIRT130353	hsa-miR-92b-3p	HITS-CLIP	22473208
MIRT130342	hsa-miR-32-5p	HITS-CLIP	22473208
MIRT734083	hsa-miR-34a-5p	PAR-CLIP	26701625
MIRT734083	hsa-miR-34a-5p	PAR-CLIP	26701625
MIRT734083	hsa-miR-34a-5p	Immunohistochemistry (IHC)	33192072
MIRT469933	hsa-miR-6768-5p	HITS-CLIP	21572407
MIRT469932	hsa-miR-5011-5p	HITS-CLIP	21572407
MIRT469930	hsa-miR-936	HITS-CLIP	21572407
MIRT469927	hsa-miR-376a-2-5p	HITS-CLIP	21572407
MIRT469925	hsa-miR-4672	HITS-CLIP	21572407
MIRT469924	hsa-miR-376a-5p	HITS-CLIP	21572407
MIRT534914	hsa-miR-4789-5p	HITS-CLIP	21572407
MIRT555122	hsa-miR-190a-3p	HITS-CLIP	21572407
MIRT469922	hsa-miR-1277-5p	HITS-CLIP	21572407
MIRT469930	hsa-miR-936	HITS-CLIP	23313552
MIRT469929	hsa-miR-190a-5p	HITS-CLIP	23313552
MIRT469928	hsa-miR-190b	HITS-CLIP	23313552
MIRT469927	hsa-miR-376a-2-5p	HITS-CLIP	23313552
MIRT469924	hsa-miR-376a-5p	HITS-CLIP	23313552
MIRT534914	hsa-miR-4789-5p	HITS-CLIP	23313552
MIRT555122	hsa-miR-190a-3p	HITS-CLIP	23313552
MIRT469922	hsa-miR-1277-5p	HITS-CLIP	23313552
MIRT654623	hsa-miR-505-3p	HITS-CLIP	23824327
MIRT654622	hsa-miR-5007-5p	HITS-CLIP	23824327
MIRT654621	hsa-miR-1303	HITS-CLIP	23824327
MIRT654620	hsa-miR-3149	HITS-CLIP	23824327
MIRT130394	hsa-miR-548c-3p	HITS-CLIP	23824327
MIRT622555	hsa-miR-627-3p	HITS-CLIP	23824327
MIRT622554	hsa-miR-6516-3p	HITS-CLIP	23824327
MIRT130394	hsa-miR-548c-3p	HITS-CLIP	23824327
MIRT622555	hsa-miR-627-3p	HITS-CLIP	23824327
MIRT622554	hsa-miR-6516-3p	HITS-CLIP	23824327
MIRT555125	hsa-miR-4280	PAR-CLIP	21572407
MIRT469932	hsa-miR-5011-5p	PAR-CLIP	21572407
MIRT555124	hsa-miR-27b-5p	PAR-CLIP	21572407
MIRT555123	hsa-miR-142-3p	PAR-CLIP	21572407
MIRT555122	hsa-miR-190a-3p	PAR-CLIP	21572407
MIRT555121	hsa-miR-3591-5p	PAR-CLIP	21572407
MIRT469922	hsa-miR-1277-5p	PAR-CLIP	21572407
MIRT469933	hsa-miR-6768-5p	PAR-CLIP	22012620
MIRT469932	hsa-miR-5011-5p	PAR-CLIP	22012620
MIRT469931	hsa-miR-511-3p	PAR-CLIP	22012620
MIRT469930	hsa-miR-936	PAR-CLIP	22012620
MIRT469929	hsa-miR-190a-5p	PAR-CLIP	22012620
MIRT469928	hsa-miR-190b	PAR-CLIP	22012620
MIRT469927	hsa-miR-376a-2-5p	PAR-CLIP	22012620
MIRT469926	hsa-miR-597-5p	PAR-CLIP	22012620
MIRT469925	hsa-miR-4672	PAR-CLIP	22012620
MIRT469924	hsa-miR-376a-5p	PAR-CLIP	22012620
MIRT534914	hsa-miR-4789-5p	PAR-CLIP	22012620
MIRT469923	hsa-miR-592	PAR-CLIP	22012620
MIRT469922	hsa-miR-1277-5p	PAR-CLIP	22012620
MIRT469933	hsa-miR-6768-5p	PAR-CLIP	23592263
MIRT469932	hsa-miR-5011-5p	PAR-CLIP	23592263
MIRT469931	hsa-miR-511-3p	PAR-CLIP	23592263
MIRT469930	hsa-miR-936	PAR-CLIP	23592263
MIRT469929	hsa-miR-190a-5p	PAR-CLIP	23592263
MIRT469928	hsa-miR-190b	PAR-CLIP	23592263
MIRT469927	hsa-miR-376a-2-5p	PAR-CLIP	23592263
MIRT469926	hsa-miR-597-5p	PAR-CLIP	23592263
MIRT469925	hsa-miR-4672	PAR-CLIP	23592263
MIRT469924	hsa-miR-376a-5p	PAR-CLIP	23592263
MIRT469923	hsa-miR-592	PAR-CLIP	23592263
MIRT469922	hsa-miR-1277-5p	PAR-CLIP	23592263
MIRT1276207	hsa-miR-1224-5p	CLIP-seq
MIRT1276208	hsa-miR-125a-5p	CLIP-seq
MIRT1276209	hsa-miR-125b	CLIP-seq
MIRT1276210	hsa-miR-1268	CLIP-seq
MIRT1276211	hsa-miR-1268b	CLIP-seq
MIRT1276212	hsa-miR-1279	CLIP-seq
MIRT1276213	hsa-miR-1291	CLIP-seq
MIRT1276214	hsa-miR-1294	CLIP-seq
MIRT1276215	hsa-miR-155	CLIP-seq
MIRT1276216	hsa-miR-15a	CLIP-seq
MIRT1276217	hsa-miR-15b	CLIP-seq
MIRT1276218	hsa-miR-16	CLIP-seq
MIRT1276219	hsa-miR-195	CLIP-seq
MIRT1276220	hsa-miR-1972	CLIP-seq
MIRT1276221	hsa-miR-205	CLIP-seq
MIRT1276222	hsa-miR-2053	CLIP-seq
MIRT1276223	hsa-miR-223	CLIP-seq
MIRT1276224	hsa-miR-23a	CLIP-seq
MIRT1276225	hsa-miR-23b	CLIP-seq
MIRT1276226	hsa-miR-23c	CLIP-seq
MIRT1276227	hsa-miR-25	CLIP-seq
MIRT1276228	hsa-miR-27a	CLIP-seq
MIRT1276229	hsa-miR-27b	CLIP-seq
MIRT1276230	hsa-miR-3064-3p	CLIP-seq
MIRT1276231	hsa-miR-3065-3p	CLIP-seq
MIRT1276232	hsa-miR-3120-3p	CLIP-seq
MIRT1276233	hsa-miR-3121-3p	CLIP-seq
MIRT1276234	hsa-miR-3148	CLIP-seq
MIRT1276235	hsa-miR-3163	CLIP-seq
MIRT1276236	hsa-miR-3175	CLIP-seq
MIRT1276237	hsa-miR-3184	CLIP-seq
MIRT1276238	hsa-miR-32	CLIP-seq
MIRT1276239	hsa-miR-328	CLIP-seq
MIRT1276240	hsa-miR-33a	CLIP-seq
MIRT1276241	hsa-miR-33b	CLIP-seq
MIRT1276242	hsa-miR-34a	CLIP-seq
MIRT1276243	hsa-miR-34b	CLIP-seq
MIRT1276244	hsa-miR-34c-3p	CLIP-seq
MIRT1276245	hsa-miR-3606	CLIP-seq
MIRT1276246	hsa-miR-3609	CLIP-seq
MIRT1276247	hsa-miR-3616-5p	CLIP-seq
MIRT1276248	hsa-miR-3620	CLIP-seq
MIRT1276249	hsa-miR-363	CLIP-seq
MIRT1276250	hsa-miR-3647-3p	CLIP-seq
MIRT1276251	hsa-miR-3647-5p	CLIP-seq
MIRT1276252	hsa-miR-3649	CLIP-seq
MIRT1276253	hsa-miR-365	CLIP-seq
MIRT1276254	hsa-miR-3653	CLIP-seq
MIRT1276255	hsa-miR-3658	CLIP-seq
MIRT1276256	hsa-miR-3662	CLIP-seq
MIRT1276257	hsa-miR-3664-5p	CLIP-seq
MIRT1276258	hsa-miR-367	CLIP-seq
MIRT1276259	hsa-miR-3684	CLIP-seq
MIRT1276260	hsa-miR-376a	CLIP-seq
MIRT1276261	hsa-miR-376b	CLIP-seq
MIRT1276262	hsa-miR-3942-5p	CLIP-seq
MIRT1276263	hsa-miR-3973	CLIP-seq
MIRT1276264	hsa-miR-423-5p	CLIP-seq
MIRT1276265	hsa-miR-424	CLIP-seq
MIRT1276266	hsa-miR-4255	CLIP-seq
MIRT1276267	hsa-miR-4292	CLIP-seq
MIRT1276268	hsa-miR-4308	CLIP-seq
MIRT1276269	hsa-miR-4319	CLIP-seq
MIRT1276270	hsa-miR-4443	CLIP-seq
MIRT1276271	hsa-miR-4452	CLIP-seq
MIRT1276272	hsa-miR-4474-3p	CLIP-seq
MIRT1276273	hsa-miR-449b	CLIP-seq
MIRT1276274	hsa-miR-4539	CLIP-seq
MIRT1276275	hsa-miR-4650-5p	CLIP-seq
MIRT1276276	hsa-miR-4668-5p	CLIP-seq
MIRT1276277	hsa-miR-4680-3p	CLIP-seq
MIRT1276278	hsa-miR-4685-5p	CLIP-seq
MIRT1276279	hsa-miR-4700-3p	CLIP-seq
MIRT1276280	hsa-miR-4703-5p	CLIP-seq
MIRT1276281	hsa-miR-4710	CLIP-seq
MIRT1276282	hsa-miR-4711-5p	CLIP-seq
MIRT1276283	hsa-miR-4714-5p	CLIP-seq
MIRT1276284	hsa-miR-4715-3p	CLIP-seq
MIRT1276285	hsa-miR-4716-3p	CLIP-seq
MIRT1276286	hsa-miR-4751	CLIP-seq
MIRT1276287	hsa-miR-4760-3p	CLIP-seq
MIRT1276288	hsa-miR-4773	CLIP-seq
MIRT1276289	hsa-miR-4776-3p	CLIP-seq
MIRT1276290	hsa-miR-4789-3p	CLIP-seq
MIRT1276291	hsa-miR-4795-5p	CLIP-seq
MIRT1276292	hsa-miR-485-3p	CLIP-seq
MIRT1276293	hsa-miR-489	CLIP-seq
MIRT1276294	hsa-miR-497	CLIP-seq
MIRT1276295	hsa-miR-500a	CLIP-seq
MIRT1276296	hsa-miR-508-5p	CLIP-seq
MIRT1276297	hsa-miR-5095	CLIP-seq
MIRT1276298	hsa-miR-513a-5p	CLIP-seq
MIRT1276299	hsa-miR-514	CLIP-seq
MIRT1276300	hsa-miR-514b-3p	CLIP-seq
MIRT1276301	hsa-miR-520g	CLIP-seq
MIRT1276302	hsa-miR-520h	CLIP-seq
MIRT1276303	hsa-miR-532-5p	CLIP-seq
MIRT1276304	hsa-miR-539	CLIP-seq
MIRT1276305	hsa-miR-544b	CLIP-seq
MIRT1276306	hsa-miR-548a-5p	CLIP-seq
MIRT1276307	hsa-miR-548ab	CLIP-seq
MIRT1276308	hsa-miR-548ac	CLIP-seq
MIRT1276309	hsa-miR-548ad	CLIP-seq
MIRT1276310	hsa-miR-548ae	CLIP-seq
MIRT1276311	hsa-miR-548ah	CLIP-seq
MIRT1276312	hsa-miR-548aj	CLIP-seq
MIRT1276313	hsa-miR-548ak	CLIP-seq
MIRT1276314	hsa-miR-548am	CLIP-seq
MIRT1276315	hsa-miR-548b-5p	CLIP-seq
MIRT1276316	hsa-miR-548c-5p	CLIP-seq
MIRT1276317	hsa-miR-548d-3p	CLIP-seq
MIRT1276318	hsa-miR-548d-5p	CLIP-seq
MIRT1276319	hsa-miR-548h	CLIP-seq
MIRT1276320	hsa-miR-548i	CLIP-seq
MIRT1276321	hsa-miR-548j	CLIP-seq
MIRT1276322	hsa-miR-548t	CLIP-seq
MIRT1276323	hsa-miR-548w	CLIP-seq
MIRT1276324	hsa-miR-548x	CLIP-seq
MIRT1276325	hsa-miR-548y	CLIP-seq
MIRT1276326	hsa-miR-548z	CLIP-seq
MIRT1276327	hsa-miR-559	CLIP-seq
MIRT1276328	hsa-miR-569	CLIP-seq
MIRT1276329	hsa-miR-573	CLIP-seq
MIRT1276330	hsa-miR-582-5p	CLIP-seq
MIRT1276331	hsa-miR-586	CLIP-seq
MIRT1276332	hsa-miR-625	CLIP-seq
MIRT1276333	hsa-miR-642b	CLIP-seq
MIRT1276334	hsa-miR-708	CLIP-seq
MIRT1276335	hsa-miR-9	CLIP-seq
MIRT1276336	hsa-miR-92a	CLIP-seq
MIRT1276337	hsa-miR-92b	CLIP-seq
MIRT1276338	hsa-miR-935	CLIP-seq
MIRT1920840	hsa-miR-323-3p	CLIP-seq
MIRT1920841	hsa-miR-4729	CLIP-seq
MIRT1920842	hsa-miR-4764-3p	CLIP-seq
MIRT1920840	hsa-miR-323-3p	CLIP-seq
MIRT1920841	hsa-miR-4729	CLIP-seq
MIRT1920842	hsa-miR-4764-3p	CLIP-seq
MIRT2081218	hsa-miR-101	CLIP-seq
MIRT2081219	hsa-miR-1183	CLIP-seq
MIRT2081220	hsa-miR-1228	CLIP-seq
MIRT2081221	hsa-miR-1229	CLIP-seq
MIRT2081222	hsa-miR-1343	CLIP-seq
MIRT2081223	hsa-miR-139-5p	CLIP-seq
MIRT2081224	hsa-miR-144	CLIP-seq
MIRT2081225	hsa-miR-199a-3p	CLIP-seq
MIRT2081226	hsa-miR-199b-3p	CLIP-seq
MIRT2081227	hsa-miR-203	CLIP-seq
MIRT2081228	hsa-miR-204	CLIP-seq
MIRT1276221	hsa-miR-205	CLIP-seq
MIRT2081229	hsa-miR-211	CLIP-seq
MIRT2081230	hsa-miR-2110	CLIP-seq
MIRT2081231	hsa-miR-221	CLIP-seq
MIRT2081232	hsa-miR-222	CLIP-seq
MIRT1276228	hsa-miR-27a	CLIP-seq
MIRT1276229	hsa-miR-27b	CLIP-seq
MIRT2081233	hsa-miR-28-3p	CLIP-seq
MIRT2081234	hsa-miR-297	CLIP-seq
MIRT1276230	hsa-miR-3064-3p	CLIP-seq
MIRT2081235	hsa-miR-3074-5p	CLIP-seq
MIRT2081236	hsa-miR-3117-5p	CLIP-seq
MIRT1276232	hsa-miR-3120-3p	CLIP-seq
MIRT2081237	hsa-miR-3129-5p	CLIP-seq
MIRT1276234	hsa-miR-3148	CLIP-seq
MIRT2081238	hsa-miR-3150a-3p	CLIP-seq
MIRT1276235	hsa-miR-3163	CLIP-seq
MIRT2081239	hsa-miR-3166	CLIP-seq
MIRT2081240	hsa-miR-3167	CLIP-seq
MIRT2081241	hsa-miR-3173-3p	CLIP-seq
MIRT2081242	hsa-miR-3192	CLIP-seq
MIRT2081243	hsa-miR-329	CLIP-seq
MIRT2081244	hsa-miR-342-3p	CLIP-seq
MIRT1276244	hsa-miR-34c-3p	CLIP-seq
MIRT2081245	hsa-miR-3612	CLIP-seq
MIRT2081246	hsa-miR-361-3p	CLIP-seq
MIRT1276247	hsa-miR-3616-5p	CLIP-seq
MIRT2081247	hsa-miR-362-3p	CLIP-seq
MIRT1276250	hsa-miR-3647-3p	CLIP-seq
MIRT1276251	hsa-miR-3647-5p	CLIP-seq
MIRT1276252	hsa-miR-3649	CLIP-seq
MIRT1276256	hsa-miR-3662	CLIP-seq
MIRT2081248	hsa-miR-3689a-3p	CLIP-seq
MIRT2081249	hsa-miR-3689c	CLIP-seq
MIRT2081250	hsa-miR-3692	CLIP-seq
MIRT2081251	hsa-miR-370	CLIP-seq
MIRT1276260	hsa-miR-376a	CLIP-seq
MIRT1276261	hsa-miR-376b	CLIP-seq
MIRT2081252	hsa-miR-3941	CLIP-seq
MIRT2081253	hsa-miR-409-3p	CLIP-seq
MIRT2081254	hsa-miR-4252	CLIP-seq
MIRT1276266	hsa-miR-4255	CLIP-seq
MIRT2081255	hsa-miR-4260	CLIP-seq
MIRT2081256	hsa-miR-4271	CLIP-seq
MIRT2081257	hsa-miR-4313	CLIP-seq
MIRT2081258	hsa-miR-4423-5p	CLIP-seq
MIRT1276270	hsa-miR-4443	CLIP-seq
MIRT1276271	hsa-miR-4452	CLIP-seq
MIRT2081259	hsa-miR-4502	CLIP-seq
MIRT2081260	hsa-miR-452	CLIP-seq
MIRT2081261	hsa-miR-4533	CLIP-seq
MIRT1276274	hsa-miR-4539	CLIP-seq
MIRT2081262	hsa-miR-4639-5p	CLIP-seq
MIRT1276276	hsa-miR-4668-5p	CLIP-seq
MIRT2081263	hsa-miR-4676-3p	CLIP-seq
MIRT2081264	hsa-miR-4676-5p	CLIP-seq
MIRT1276277	hsa-miR-4680-3p	CLIP-seq
MIRT1276278	hsa-miR-4685-5p	CLIP-seq
MIRT2081265	hsa-miR-4691-3p	CLIP-seq
MIRT1276279	hsa-miR-4700-3p	CLIP-seq
MIRT1276284	hsa-miR-4715-3p	CLIP-seq
MIRT1276285	hsa-miR-4716-3p	CLIP-seq
MIRT2081266	hsa-miR-4719	CLIP-seq
MIRT2081267	hsa-miR-4725-3p	CLIP-seq
MIRT2081268	hsa-miR-4727-5p	CLIP-seq
MIRT2081269	hsa-miR-4728-5p	CLIP-seq
MIRT2081270	hsa-miR-4747-5p	CLIP-seq
MIRT1276287	hsa-miR-4760-3p	CLIP-seq
MIRT2081271	hsa-miR-4766-5p	CLIP-seq
MIRT2081272	hsa-miR-4769-3p	CLIP-seq
MIRT2081273	hsa-miR-4774-3p	CLIP-seq
MIRT1276290	hsa-miR-4789-3p	CLIP-seq
MIRT1276291	hsa-miR-4795-5p	CLIP-seq
MIRT2081274	hsa-miR-498	CLIP-seq
MIRT1276296	hsa-miR-508-5p	CLIP-seq
MIRT1276297	hsa-miR-5095	CLIP-seq
MIRT1276298	hsa-miR-513a-5p	CLIP-seq
MIRT2081275	hsa-miR-544	CLIP-seq
MIRT1276309	hsa-miR-548ad	CLIP-seq
MIRT1276322	hsa-miR-548t	CLIP-seq
MIRT2081276	hsa-miR-548v	CLIP-seq
MIRT2081277	hsa-miR-567	CLIP-seq
MIRT2081278	hsa-miR-570	CLIP-seq
MIRT1276329	hsa-miR-573	CLIP-seq
MIRT2081279	hsa-miR-575	CLIP-seq
MIRT1276330	hsa-miR-582-5p	CLIP-seq
MIRT2081280	hsa-miR-587	CLIP-seq
MIRT2081281	hsa-miR-603	CLIP-seq
MIRT2081282	hsa-miR-604	CLIP-seq
MIRT2081283	hsa-miR-616	CLIP-seq
MIRT1276332	hsa-miR-625	CLIP-seq
MIRT1276333	hsa-miR-642b	CLIP-seq
MIRT2081284	hsa-miR-647	CLIP-seq
MIRT2081285	hsa-miR-650	CLIP-seq
MIRT2081286	hsa-miR-876-5p	CLIP-seq
MIRT1276335	hsa-miR-9	CLIP-seq
MIRT2081287	hsa-miR-924	CLIP-seq
MIRT2081288	hsa-miR-943	CLIP-seq
MIRT2307125	hsa-miR-1178	CLIP-seq
MIRT2307126	hsa-miR-1197	CLIP-seq
MIRT2081220	hsa-miR-1228	CLIP-seq
MIRT2081221	hsa-miR-1229	CLIP-seq
MIRT2307127	hsa-miR-124	CLIP-seq
MIRT2307128	hsa-miR-1245b-3p	CLIP-seq
MIRT2307129	hsa-miR-1257	CLIP-seq
MIRT1276210	hsa-miR-1268	CLIP-seq
MIRT1276211	hsa-miR-1268b	CLIP-seq
MIRT1276212	hsa-miR-1279	CLIP-seq
MIRT2307130	hsa-miR-128	CLIP-seq
MIRT2307131	hsa-miR-1289	CLIP-seq
MIRT1276213	hsa-miR-1291	CLIP-seq
MIRT1276214	hsa-miR-1294	CLIP-seq
MIRT2307132	hsa-miR-132	CLIP-seq
MIRT2307133	hsa-miR-135a	CLIP-seq
MIRT2307134	hsa-miR-135b	CLIP-seq
MIRT2081224	hsa-miR-144	CLIP-seq
MIRT1276216	hsa-miR-15a	CLIP-seq
MIRT1276217	hsa-miR-15b	CLIP-seq
MIRT1276218	hsa-miR-16	CLIP-seq
MIRT2307135	hsa-miR-1825	CLIP-seq
MIRT1276219	hsa-miR-195	CLIP-seq
MIRT2307136	hsa-miR-199a-5p	CLIP-seq
MIRT2307137	hsa-miR-199b-5p	CLIP-seq
MIRT1276221	hsa-miR-205	CLIP-seq
MIRT2081230	hsa-miR-2110	CLIP-seq
MIRT2307138	hsa-miR-212	CLIP-seq
MIRT1276224	hsa-miR-23a	CLIP-seq
MIRT1276225	hsa-miR-23b	CLIP-seq
MIRT1276226	hsa-miR-23c	CLIP-seq
MIRT1276227	hsa-miR-25	CLIP-seq
MIRT1276228	hsa-miR-27a	CLIP-seq
MIRT1276229	hsa-miR-27b	CLIP-seq
MIRT2081234	hsa-miR-297	CLIP-seq
MIRT1276230	hsa-miR-3064-3p	CLIP-seq
MIRT2307139	hsa-miR-3065-5p	CLIP-seq
MIRT2081236	hsa-miR-3117-5p	CLIP-seq
MIRT2307140	hsa-miR-3119	CLIP-seq
MIRT1276232	hsa-miR-3120-3p	CLIP-seq
MIRT2307141	hsa-miR-3126-5p	CLIP-seq
MIRT2081238	hsa-miR-3150a-3p	CLIP-seq
MIRT1276235	hsa-miR-3163	CLIP-seq
MIRT2307142	hsa-miR-3168	CLIP-seq
MIRT2081241	hsa-miR-3173-3p	CLIP-seq
MIRT1276237	hsa-miR-3184	CLIP-seq
MIRT2307143	hsa-miR-3198	CLIP-seq
MIRT1276238	hsa-miR-32	CLIP-seq
MIRT1276239	hsa-miR-328	CLIP-seq
MIRT2081243	hsa-miR-329	CLIP-seq
MIRT2081244	hsa-miR-342-3p	CLIP-seq
MIRT2307144	hsa-miR-342-5p	CLIP-seq
MIRT1276243	hsa-miR-34b	CLIP-seq
MIRT1276244	hsa-miR-34c-3p	CLIP-seq
MIRT1276245	hsa-miR-3606	CLIP-seq
MIRT2307145	hsa-miR-3607-5p	CLIP-seq
MIRT1276247	hsa-miR-3616-5p	CLIP-seq
MIRT2081247	hsa-miR-362-3p	CLIP-seq
MIRT1276249	hsa-miR-363	CLIP-seq
MIRT1276250	hsa-miR-3647-3p	CLIP-seq
MIRT1276251	hsa-miR-3647-5p	CLIP-seq
MIRT2307146	hsa-miR-3652	CLIP-seq
MIRT1276258	hsa-miR-367	CLIP-seq
MIRT2307147	hsa-miR-3907	CLIP-seq
MIRT2307148	hsa-miR-3940-5p	CLIP-seq
MIRT2081252	hsa-miR-3941	CLIP-seq
MIRT2307149	hsa-miR-3943	CLIP-seq
MIRT2081253	hsa-miR-409-3p	CLIP-seq
MIRT2307150	hsa-miR-421	CLIP-seq
MIRT1276264	hsa-miR-423-5p	CLIP-seq
MIRT1276265	hsa-miR-424	CLIP-seq
MIRT1276266	hsa-miR-4255	CLIP-seq
MIRT2081255	hsa-miR-4260	CLIP-seq
MIRT2081256	hsa-miR-4271	CLIP-seq
MIRT2307151	hsa-miR-4275	CLIP-seq
MIRT2307152	hsa-miR-4286	CLIP-seq
MIRT2307153	hsa-miR-4294	CLIP-seq
MIRT2307154	hsa-miR-4309	CLIP-seq
MIRT2081257	hsa-miR-4313	CLIP-seq
MIRT2307155	hsa-miR-4318	CLIP-seq
MIRT2307156	hsa-miR-4323	CLIP-seq
MIRT2307157	hsa-miR-4326	CLIP-seq
MIRT2081258	hsa-miR-4423-5p	CLIP-seq
MIRT2307158	hsa-miR-4430	CLIP-seq
MIRT2307159	hsa-miR-4433	CLIP-seq
MIRT2307160	hsa-miR-4436a	CLIP-seq
MIRT1276270	hsa-miR-4443	CLIP-seq
MIRT1276271	hsa-miR-4452	CLIP-seq
MIRT2307161	hsa-miR-4459	CLIP-seq
MIRT2307162	hsa-miR-4506	CLIP-seq
MIRT2307163	hsa-miR-4507	CLIP-seq
MIRT2081261	hsa-miR-4533	CLIP-seq
MIRT1276274	hsa-miR-4539	CLIP-seq
MIRT2307164	hsa-miR-455-5p	CLIP-seq
MIRT2307165	hsa-miR-4664-5p	CLIP-seq
MIRT2081264	hsa-miR-4676-5p	CLIP-seq
MIRT1276277	hsa-miR-4680-3p	CLIP-seq
MIRT2081265	hsa-miR-4691-3p	CLIP-seq
MIRT2307166	hsa-miR-4695-5p	CLIP-seq
MIRT1276279	hsa-miR-4700-3p	CLIP-seq
MIRT2307167	hsa-miR-4704-3p	CLIP-seq
MIRT2307168	hsa-miR-4709-5p	CLIP-seq
MIRT1276281	hsa-miR-4710	CLIP-seq
MIRT1276282	hsa-miR-4711-5p	CLIP-seq
MIRT1276284	hsa-miR-4715-3p	CLIP-seq
MIRT2081266	hsa-miR-4719	CLIP-seq
MIRT2081267	hsa-miR-4725-3p	CLIP-seq
MIRT2307169	hsa-miR-4742-3p	CLIP-seq
MIRT2081270	hsa-miR-4747-5p	CLIP-seq
MIRT1276287	hsa-miR-4760-3p	CLIP-seq
MIRT2307170	hsa-miR-4768-3p	CLIP-seq
MIRT1276288	hsa-miR-4773	CLIP-seq
MIRT2307171	hsa-miR-4779	CLIP-seq
MIRT1276290	hsa-miR-4789-3p	CLIP-seq
MIRT1276291	hsa-miR-4795-5p	CLIP-seq
MIRT2307172	hsa-miR-483-3p	CLIP-seq
MIRT1276292	hsa-miR-485-3p	CLIP-seq
MIRT2307173	hsa-miR-485-5p	CLIP-seq
MIRT1276294	hsa-miR-497	CLIP-seq
MIRT1276295	hsa-miR-500a	CLIP-seq
MIRT2307174	hsa-miR-506	CLIP-seq
MIRT1276296	hsa-miR-508-5p	CLIP-seq
MIRT1276297	hsa-miR-5095	CLIP-seq
MIRT1276298	hsa-miR-513a-5p	CLIP-seq
MIRT2307175	hsa-miR-513c	CLIP-seq
MIRT2307176	hsa-miR-514b-5p	CLIP-seq
MIRT2307177	hsa-miR-548aa	CLIP-seq
MIRT1276308	hsa-miR-548ac	CLIP-seq
MIRT1276309	hsa-miR-548ad	CLIP-seq
MIRT1276310	hsa-miR-548ae	CLIP-seq
MIRT1276312	hsa-miR-548aj	CLIP-seq
MIRT1276314	hsa-miR-548am	CLIP-seq
MIRT2307178	hsa-miR-548an	CLIP-seq
MIRT1276317	hsa-miR-548d-3p	CLIP-seq
MIRT1276322	hsa-miR-548t	CLIP-seq
MIRT1276324	hsa-miR-548x	CLIP-seq
MIRT1276326	hsa-miR-548z	CLIP-seq
MIRT2081277	hsa-miR-567	CLIP-seq
MIRT1276329	hsa-miR-573	CLIP-seq
MIRT2081279	hsa-miR-575	CLIP-seq
MIRT1276330	hsa-miR-582-5p	CLIP-seq
MIRT1276331	hsa-miR-586	CLIP-seq
MIRT2307179	hsa-miR-597	CLIP-seq
MIRT2081281	hsa-miR-603	CLIP-seq
MIRT2307180	hsa-miR-607	CLIP-seq
MIRT2081283	hsa-miR-616	CLIP-seq
MIRT1276333	hsa-miR-642b	CLIP-seq
MIRT2307181	hsa-miR-665	CLIP-seq
MIRT2307182	hsa-miR-7	CLIP-seq
MIRT1276336	hsa-miR-92a	CLIP-seq
MIRT1276337	hsa-miR-92b	CLIP-seq
MIRT2307133	hsa-miR-135a	CLIP-seq
MIRT2307134	hsa-miR-135b	CLIP-seq
MIRT1276228	hsa-miR-27a	CLIP-seq
MIRT1276229	hsa-miR-27b	CLIP-seq
MIRT1276230	hsa-miR-3064-3p	CLIP-seq
MIRT2081236	hsa-miR-3117-5p	CLIP-seq
MIRT1276232	hsa-miR-3120-3p	CLIP-seq
MIRT2081239	hsa-miR-3166	CLIP-seq
MIRT1276244	hsa-miR-34c-3p	CLIP-seq
MIRT1276247	hsa-miR-3616-5p	CLIP-seq
MIRT1276251	hsa-miR-3647-5p	CLIP-seq
MIRT1276266	hsa-miR-4255	CLIP-seq
MIRT2307157	hsa-miR-4326	CLIP-seq
MIRT1276271	hsa-miR-4452	CLIP-seq
MIRT2081264	hsa-miR-4676-5p	CLIP-seq
MIRT1276277	hsa-miR-4680-3p	CLIP-seq
MIRT1276284	hsa-miR-4715-3p	CLIP-seq
MIRT1276290	hsa-miR-4789-3p	CLIP-seq
MIRT1276291	hsa-miR-4795-5p	CLIP-seq
MIRT1276298	hsa-miR-513a-5p	CLIP-seq
MIRT1276329	hsa-miR-573	CLIP-seq
MIRT2081279	hsa-miR-575	CLIP-seq
MIRT2081282	hsa-miR-604	CLIP-seq
MIRT2081284	hsa-miR-647	CLIP-seq
MIRT1276250	hsa-miR-3647-3p	CLIP-seq
MIRT1276279	hsa-miR-4700-3p	CLIP-seq
MIRT1276297	hsa-miR-5095	CLIP-seq
MIRT1276330	hsa-miR-582-5p	CLIP-seq
MIRT2604661	hsa-miR-1227	CLIP-seq
MIRT2604662	hsa-miR-3130-3p	CLIP-seq
MIRT2604663	hsa-miR-3650	CLIP-seq
MIRT2307164	hsa-miR-455-5p	CLIP-seq
MIRT2604664	hsa-miR-4659a-5p	CLIP-seq
MIRT2604665	hsa-miR-4659b-5p	CLIP-seq
MIRT2604666	hsa-miR-4666-5p	CLIP-seq
MIRT2604667	hsa-miR-4716-5p	CLIP-seq
MIRT1920842	hsa-miR-4764-3p	CLIP-seq
MIRT2604668	hsa-miR-4781-3p	CLIP-seq
MIRT2604669	hsa-miR-660	CLIP-seq
MIRT2604662	hsa-miR-3130-3p	CLIP-seq
MIRT2604663	hsa-miR-3650	CLIP-seq
MIRT2604664	hsa-miR-4659a-5p	CLIP-seq
MIRT2604665	hsa-miR-4659b-5p	CLIP-seq
MIRT2604667	hsa-miR-4716-5p	CLIP-seq
MIRT2604668	hsa-miR-4781-3p	CLIP-seq
MIRT2604669	hsa-miR-660	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001525	Process	Angiogenesis	IEA
GO:0001570	Process	Vasculogenesis	IEA
GO:0001772	Component	Immunological synapse	IDA	12913111
GO:0001772	Component	Immunological synapse	IEA
GO:0001954	Process	Positive regulation of cell-matrix adhesion	IEA
GO:0002376	Process	Immune system process	IEA
GO:0004721	Function	Phosphoprotein phosphatase activity	IEA
GO:0004725	Function	Protein tyrosine phosphatase activity	IBA
GO:0004725	Function	Protein tyrosine phosphatase activity	IDA	9531590, 10821867, 12913111, 18348712, 18936167, 19332538
GO:0004725	Function	Protein tyrosine phosphatase activity	IEA
GO:0004725	Function	Protein tyrosine phosphatase activity	IMP	9780142, 12475979
GO:0004725	Function	Protein tyrosine phosphatase activity	TAS
GO:0005161	Function	Platelet-derived growth factor receptor binding	IPI	10821867
GO:0005515	Function	Protein binding	IPI	10821867, 12370829, 12475979, 12771128, 16893970, 18936167, 19167335, 19494114
GO:0005576	Component	Extracellular region	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005730	Component	Nucleolus	IDA
GO:0005886	Component	Plasma membrane	IDA	9531590, 18348712, 19836242
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	7937872
GO:0005911	Component	Cell-cell junction	IDA	12370829, 19332538
GO:0007165	Process	Signal transduction	IBA
GO:0007411	Process	Axon guidance	IBA
GO:0007507	Process	Heart development	IEA
GO:0007596	Process	Blood coagulation	IEA
GO:0008013	Function	Beta-catenin binding	IPI	12370829
GO:0008285	Process	Negative regulation of cell population proliferation	IDA	14709717, 16682945
GO:0008285	Process	Negative regulation of cell population proliferation	IEA
GO:0009653	Process	Anatomical structure morphogenesis	IEA
GO:0009986	Component	Cell surface	IDA	12913111
GO:0010572	Process	Positive regulation of platelet activation	IEA
GO:0010642	Process	Negative regulation of platelet-derived growth factor receptor signaling pathway	IDA	14709717
GO:0010642	Process	Negative regulation of platelet-derived growth factor receptor signaling pathway	IEA
GO:0010759	Process	Positive regulation of macrophage chemotaxis	IEA
GO:0016020	Component	Membrane	IEA
GO:0016604	Component	Nuclear body	IDA
GO:0016787	Function	Hydrolase activity	IEA
GO:0016791	Function	Phosphatase activity	IDA	12062403, 12370829, 19494114
GO:0016791	Function	Phosphatase activity	IMP	11259588, 19836242
GO:0019221	Process	Cytokine-mediated signaling pathway	TAS
GO:0019901	Function	Protein kinase binding	IPI	19332538
GO:0030054	Component	Cell junction	IDA
GO:0030097	Process	Hemopoiesis	IEA
GO:0030155	Process	Regulation of cell adhesion	IMP	12370829
GO:0030183	Process	B cell differentiation	IEA
GO:0030183	Process	B cell differentiation	ISS
GO:0030220	Process	Platelet formation	IMP	30591527
GO:0030308	Process	Negative regulation of cell growth	IDA	14709717
GO:0030336	Process	Negative regulation of cell migration	IDA	16682945
GO:0030336	Process	Negative regulation of cell migration	IEA
GO:0032587	Component	Ruffle membrane	IEA
GO:0032760	Process	Positive regulation of tumor necrosis factor production	IEA
GO:0032760	Process	Positive regulation of tumor necrosis factor production	ISS
GO:0035335	Process	Peptidyl-tyrosine dephosphorylation	IDA	9531590, 10821867, 12913111, 18348712, 18936167, 19332538
GO:0035335	Process	Peptidyl-tyrosine dephosphorylation	IMP	9780142, 12475979
GO:0035579	Component	Specific granule membrane	TAS
GO:0042059	Process	Negative regulation of epidermal growth factor receptor signaling pathway	IMP	19836242
GO:0042593	Process	Glucose homeostasis	IEA
GO:0042995	Component	Cell projection	IEA
GO:0043116	Process	Negative regulation of vascular permeability	IDA	19332538
GO:0043407	Process	Negative regulation of MAP kinase activity	IDA	19494114
GO:0043410	Process	Positive regulation of MAPK cascade	IEA
GO:0043410	Process	Positive regulation of MAPK cascade	ISS
GO:0045295	Function	Gamma-catenin binding	IPI	12370829
GO:0045296	Function	Cadherin binding	IEA
GO:0045296	Function	Cadherin binding	IPI	28926625
GO:0045785	Process	Positive regulation of cell adhesion	IMP	21091576
GO:0046627	Process	Negative regulation of insulin receptor signaling pathway	IEA
GO:0048008	Process	Platelet-derived growth factor receptor signaling pathway	IMP	21091576
GO:0048709	Process	Oligodendrocyte differentiation	IEA
GO:0050766	Process	Positive regulation of phagocytosis	IEA
GO:0050766	Process	Positive regulation of phagocytosis	ISS
GO:0050778	Process	Positive regulation of immune response	IEA
GO:0050850	Process	Positive regulation of calcium-mediated signaling	IEA
GO:0050850	Process	Positive regulation of calcium-mediated signaling	ISS
GO:0050852	Process	T cell receptor signaling pathway	TAS
GO:0050860	Process	Negative regulation of T cell receptor signaling pathway	IDA	12913111
GO:0050860	Process	Negative regulation of T cell receptor signaling pathway	IEA
GO:0050860	Process	Negative regulation of T cell receptor signaling pathway	IMP	9780142, 11259588
GO:0050918	Process	Positive chemotaxis	IDA	14709717
GO:0051019	Function	Mitogen-activated protein kinase binding	IPI	19494114
GO:0051130	Process	Positive regulation of cellular component organization	IEA
GO:0051894	Process	Positive regulation of focal adhesion assembly	IMP	21091576
GO:0051897	Process	Positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	IMP	18936167
GO:0051898	Process	Negative regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	IMP	19922411
GO:0060242	Process	Contact inhibition	NAS	7937872
GO:0060369	Process	Positive regulation of Fc receptor mediated stimulatory signaling pathway	IEA
GO:0060369	Process	Positive regulation of Fc receptor mediated stimulatory signaling pathway	ISS	18249142
GO:0065008	Process	Regulation of biological quality	IEA
GO:0070062	Component	Extracellular exosome	HDA	19056867, 23533145
GO:0070097	Function	Delta-catenin binding	IPI	12370829, 19332538
GO:0070161	Component	Anchoring junction	IEA
GO:1902533	Process	Positive regulation of intracellular signal transduction	IEA

Other IDs

• MIM: 600925
• HGNC: 9673
• e!Ensembl: ENSG00000149177

Protein

• UniProt ID: Q12913
• Protein name: Receptor-type tyrosine-protein phosphatase eta (Protein-tyrosine phosphatase eta) (R-PTP-eta) (EC 3.1.3.48) (Density-enhanced phosphatase 1) (DEP-1) (HPTP eta) (Protein-tyrosine phosphatase receptor type J) (R-PTP-J) (CD antigen CD148)
• Protein function: Tyrosine phosphatase which dephosphorylates or contributes to the dephosphorylation of CTNND1, FLT3, PDGFRB, MET, KDR, LYN, SRC, MAPK1, MAPK3, EGFR, TJP1, OCLN, PIK3R1 and PIK3R2 (PubMed:10821867, PubMed:12062403, PubMed:12370829, PubMed:1247597
• PDB: 2CFV, 2DLE, 2NZ6, 7U01, 7U08
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00041	fn3	120 → 199	Fibronectin type III domain	Domain
  PF00041	fn3	368 → 445	Fibronectin type III domain	Domain
  PF18861	PTP_tm	835 → 1000	Transmembrane domain of protein tyrosine phosphatase, receptor type J	Family
  PF00102	Y_phosphatase	1065 → 1297	Protein-tyrosine phosphatase	Domain

• Tissue specificity: TISSUE SPECIFICITY: Expressed in the promyelocytic cell line HL-60, the granulocyte-macrophage colony-stimulating factor-dependent leukemic cell line F-36P, and the IL3 and erythropoietin-dependent leukemic cell line F-36E. Expressed predominantly in epit
• Sequence:

  MKPAAREARLPPRSPGLRWALPLLLLLLRLGQILCAGGTPSPIPDPSVATVATGENGITQ
  ISSTAESFHKQNGTGTPQVETNTSEDGESSGANDSLRTPEQGSNGTDGASQKTPSSTGPS
  PVFDIKAVSISPTNVILTWKSNDTAASEYKYVVKHKMENEKTITVVHQPWCNITGLRPAT
  SYVFSITPGIGNETWGDPRVIKVITEPIPVSDLRVALTGVRKAALSWSNGNGTASCRVLL
  ESIGSHEELTQDSRLQVNISGLKPGVQYNINPYLLQSNKTKGDPLGTEGGLDASNTERSR
  AGSPTAPVHDESLVGPVDPSSGQQSRDTEVLLVGLEPGTRYNATVYSQAANGTEGQPQAI
  EFRTNAIQVFDVTAVNISATSLTLIWKVSDNESSSNYTYKIHVAGETDSSNLNVSEPRAV
  IPGLRSSTFYNITVCPVLGDIEGTPGFLQVHTPPVPVSDFRVTVVSTTEIGLAWSSHDAE
  SFQMHITQEGAGNSRVEITTNQSIIIGGLFPGTKYCFEIVPKGPNGTEGASRTVCNRTVP
  SAVFDIHVVYVTTTEMWLDWKSPDGASEYVYHLVIESKHGSNHTSTYDKAITLQGLIPGT
  LYNITISPEVDHVWGDPNSTAQYTRPSNVSNIDVSTNTTAATLSWQNFDDASPTYSYCLL
  IEKAGNSSNATQVVTDIGITDATVTELIPGSSYTVEIFAQVGDGIKSLEPGRKSFCTDPA
  SMASFDCEVVPKEPALVLKWTCPPGANAGFELEVSSGAWNNATHLESCSSENGTEYRTEV
  TYLNFSTSYNISITTVSCGKMAAPTRNTCTTGITDPPPPDGSPNITSVSHNSVKVKFSGF
  EASHGPIKAYAVILTTGEAGHPSADVLKYTYEDFKKGASDTYVTYLIRTEEKGRSQSLSE
  VLKYEIDVGNESTTLGYYNGKLEPLGSYRACVAGFTNITFHPQNKGLIDGAESYVSFSRY
  SDAVSLPQDPGVICGAVFGCIFGALVIVTVGGFIFWRKKRKDAKNNEVSFSQIKPKKSKL
  IRVENFEAYFKKQQADSNCGFAEEYEDLKLVGISQPKYAAELAENRGKNRYNNVLPYDIS
  RVKLSVQTHSTDDYINANYMPGYHSKKDFIATQGPLPNTLKDFWRMVWEKNVYAIIMLTK
  CVEQGRTKCEEYWPSKQAQDYGDITVAMTSEIVLPEWTIRDFTVKNIQTSESHPLRQFHF
  TSWPDHGVPDTTDLLINFRYLVRDYMKQSPPESPILVHCSAGVGRTGTFIAIDRLIYQIE
  NENTVDVYGIVYDLRMHRPLMVQTEDQYVFLNQCVLDIVRSQKDSKVDLIYQNTTAMTIY
  ENLAPVTTFGKTNGYIA

• Sequence length: 1337

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Causal
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Carcinoma of colon	Pathogenic	rs121434507	RCV000009226	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Thrombocytopenia 10	Pathogenic	rs758226104, rs2495194878	RCV003324883 RCV003324884	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ATRIAL FIBRILLATION	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHILDHOOD ACUTE LYMPHOBLASTIC LEUKEMIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Clear cell carcinoma of kidney	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLOR VISION DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal cancer	Conflicting classifications of pathogenicity	ClinVar ClinVar, HPO ClinVar, HPO	★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
COLORECTAL NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERY DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatocellular carcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEREDITARY NONPOLYPOSIS COLON CANCER	—	ClinGen, GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSION	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of esophagus	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MOOD DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MUCOCUTANEOUS LYMPH NODE SYNDROME	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL INFARCTION	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEUROTIC DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS, HIP	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS, KNEE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PTPRJ-related disorder	Conflicting classifications of pathogenicity; Uncertain significance; Likely benign; Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
THROMBOCYTOPENIA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 1 DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
VENOUS THROMBOEMBOLISM	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adenocarcinoma	Adenocarcinoma	BEFREE	30275185		★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	12776199, 15378013		★☆☆☆☆ Found in Text Mining only
Adult Diffuse Large B-Cell Lymphoma	B-cell Lymphoma	BEFREE	12685844		★☆☆☆☆ Found in Text Mining only
Anaplasia	Anaplasia	BEFREE	10599888		★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	24016860		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	39380119	Associate	★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	12685844, 23341091, 24885312		★☆☆☆☆ Found in Text Mining only
Blood Coagulation Disorders	Blood Coagulation Disorders	BEFREE	19246339		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	16000320, 18843023, 25772245, 28316102, 8797598		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	12475979, 9115287	Associate	★☆☆☆☆ Found in Text Mining only
Cachexia	Cachexia	Pubtator	27879288	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	20823296, 22076464	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	10599888, 15231692, 15378013, 7994032		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	28316102		★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	23007793	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	34791835	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	35791609	Inhibit	★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	12089527, 12776199, 16000320, 16682945, 19672627		★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	CGI_DG			★☆☆☆☆ Found in Text Mining only
Colorectal cancer, hereditary nonpolyposis, type 1	Colorectal Cancer	CLINGEN_DG	28316102		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	12776199, 18843023, 19672627, 28316102, 30661225		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	CLINVAR_DG			★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	16258161, 24338422, 28031238	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Crohn Disease	Crohn Disease	BEFREE	10599888		★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	12685844		★☆☆☆☆ Found in Text Mining only
Epithelioma	Epithelioma	BEFREE	21091576		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	26694178	Inhibit	★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	26694178, 36578050	Associate	★☆☆☆☆ Found in Text Mining only
Glaucoma	Glaucoma	Pubtator	39342991	Associate	★☆☆☆☆ Found in Text Mining only
Glaucoma, Primary Open Angle	Glaucoma	BEFREE	28832686		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	34301218	Associate	★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	15123617		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	15123617, 28052032	Associate	★☆☆☆☆ Found in Text Mining only
Hereditary Non-Polyposis Colon Cancer Type 2	Colorectal Cancer	CLINGEN_DG	28316102		★☆☆☆☆ Found in Text Mining only
Hereditary non-polyposis colorectal cancer syndrome	Hereditary nonpolyposis colorectal cancer	CLINGEN_DG	28316102		★☆☆☆☆ Found in Text Mining only
Hereditary Nonpolyposis Colorectal Cancer	Colorectal Cancer	CLINGEN_DG	28316102		★☆☆☆☆ Found in Text Mining only
Hereditary Nonpolyposis Colorectal Neoplasms	Colorectal Neoplasms	CLINGEN_DG	28316102		★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	27535281	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	22438257		★☆☆☆☆ Found in Text Mining only
Low Tension Glaucoma	Low Tension Glaucoma	BEFREE	28832686		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	LHGDN	12685844		★☆☆☆☆ Found in Text Mining only
Lymphoma Follicular	Lymphoma	Pubtator	23341091, 24885312	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma, Follicular	Lymphoma	BEFREE	12685844		★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin	Non-Hodgkin lymphoma	BEFREE	23341091		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	16000320, 18843023, 25772245, 28316102, 8797598		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	28316102		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	15231692		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of thyroid	Thyroid cancer	BEFREE	15384144		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	10599888, 16000320, 19672627, 20823296, 28423495, 30661225		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	12089527, 12776199, 16000320, 16682945, 19672627		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	UNIPROT_DG			★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	16000320		★☆☆☆☆ Found in Text Mining only
Mantle cell lymphoma	Mantle Cell Lymphoma	BEFREE	26261659		★☆☆☆☆ Found in Text Mining only
Marginal Zone B-Cell Lymphoma	B-Cell Lymphoma	BEFREE	12685844		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	30188888		★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	BEFREE	21091576, 25672645, 31715329		★☆☆☆☆ Found in Text Mining only
Mitral Valve Prolapse	Mitral valve prolapse	Pubtator	29762926	Associate	★☆☆☆☆ Found in Text Mining only
Mucosa-Associated Lymphoid Tissue Lymphoma	Mucosa-associated lymphoma	BEFREE	12685844		★☆☆☆☆ Found in Text Mining only
Myeloproliferative disease	Myeloproliferative disorder	BEFREE	21262971, 22438257		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	15123617, 15231692, 16000320, 16682945, 16778204, 20823296, 23840844, 28052032, 28316102, 28423495, 28628728, 29805737, 29937175, 30188888, 30661225		★☆☆☆☆ Found in Text Mining only
Neurofibromatosis 2	Neurofibromatosis	BEFREE	31715329		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	28912580		★☆☆☆☆ Found in Text Mining only
Oculovestibuloauditory syndrome	Oculovestibuloauditory Syndrome	BEFREE	16582570		★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	20823296		★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	GWASDB_DG	22076464		★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	GWASCAT_DG	22076464		★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	28886261		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	24016860		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	28789700, 29323724		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	19484147, 20705629, 26098778, 26177470, 31462653		★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	20823296	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	11094075, 15378013, 15384144		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	15378013		★☆☆☆☆ Found in Text Mining only
Tongue Neoplasms	Tongue Neoplasms	BEFREE	22020886		★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	35791609	Associate	★☆☆☆☆ Found in Text Mining only